KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0370Help
Entry
SG0370            CDS       T00770                                 

Gene name
res
Definition
type III restriction-modification system protein (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
403278..406253
Genome map
AA seq 991 aa AA seqDB search
MMMNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKERYDDKANIDVKMETGT
GKTYVYTRLMYELHQKYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELC
TINAGDFKVKSGRKNSPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLG
GLTSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNK
CVRKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRG
SKIAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDA
IDKHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKVTFERLLKKKLTQ
LIDDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKN
KEKLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRL
PVDENGHRVHQEEWPSRLSFLIGYDEKAFASMLVDEINRDSKVQLNEQKLDEAMITLIVT
ERQKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVR
ADRIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPAL
YIRQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMVGMKYGHFLKQLALRTSLPVNVL
HPVLMAMLRDVLHGDSRYLSEISLDNMTRALQTRINAHFAQCHDYLPLDFQASTSVFDST
ARQFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKL
PKRAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDML
RRQNINVEFAEATSAPAVFSTINGLIEGKAN
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaatattttactggaggaacttccccatcaggaacaggcgttagcggcgatt
ctggcgagtttcaccggtatcgatcacgcgcaggccgatcataatcactatgctaatccg
ctgattaaggaacgttacgacgataaggccaatattgacgttaaaatggagaccgggacg
ggcaaaacctatgtctatacccggttgatgtatgaactgcatcagaagtatggcctcttc
aaatttgtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttatcacc
agcgattacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgc
accatcaacgccggtgattttaaagtaaagtcggggcgtaaaaattctccggcccagtta
ttaagttttactgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaat
gcgcaaatgctcaattccgccagtatgacgcgagacgattacgatcaaacgctactgggc
gggctgacgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaa
ccgcatcgttttgcgcgagataacaaattttatcgagcgattcaggccattcagccgcaa
atgatcgtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaa
tgtgtacgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagt
tttaacgatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacag
gccaacaatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacggggg
agcaaaattgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaa
ggcagtatcgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcaggg
atggcgctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgct
atcgataagcattttgacactgagcaggcaaatttcttacgcagcaatgagccagaaaat
aatgccccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgt
gatgacgaaggctggttgaaagtcacttttgagcgtttgctgaaaaagaaactgacgcaa
ctgattgacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctg
caggccacgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggc
gaagaccgcggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaat
aaagagaagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctg
ttttcaaaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaa
ttacgttcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggcta
ccggtagatgaaaacggccatcgcgttcatcaggaagagtggccgtcccgactgtcgttt
ctgattggttatgatgaaaaagcgtttgccagtatgctggttgatgagattaatcgcgac
agcaaagttcagcttaacgagcagaaactggatgaggcgatgatcacactcatcgtcacc
gagcggcaaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgat
aaaaaactgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacggggaaacc
aaaagtggttttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcga
gcggatcgcattcgtgacaataagcccgcctcccgactgcgagtcaggttacgcaaagag
aattgggaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattc
gagcgtagcggcgcgtctctggaacagattgccgccgaggtgctgcgcgatccggcgctg
tatatacgccagaagccaagccaggtgcaacaacggctggtatcgaatgaagataatggc
cgttttgaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggtgggcatg
aaatatggccattttcttaagcaactggcgttacgcaccagtctgccggttaacgtcctg
cacccggtgttaatggcgatgctgcgtgatgttttgcacggagattcacgctatttaagc
gagatctcgttggacaatatgacccgcgcattacagacgcggattaatgcgcattttgcg
cagtgccacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattccacg
gcacggcagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaat
gcgatagacgatccccgttccctctatcaaataccgccgttgcgttatgacagcgtcgat
ccagaattgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaactg
cctaagcgggccattcagatccccaaatatacggggggctctactacgccggattttgtg
taccgtattgagcgtcaggacgccgacagtgtttatttactggttgaaactaaagcagaa
aatatgcgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctg
cgtcggcaaaatatcaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttct
acgatcaatggcttgattgaggggaaggcaaactaa

DBGET integrated database retrieval system