KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0716Help
Entry
SG0716            CDS       T00770                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00020  Citrate cycle (TCA cycle)
seg00190  Oxidative phosphorylation
seg00650  Butanoate metabolism
seg01100  Metabolic pathways
seg01110  Biosynthesis of secondary metabolites
seg01120  Microbial metabolism in diverse environments
seg01130  Biosynthesis of antibiotics
seg01200  Carbon metabolism
Module
seg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
seg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG0716 (sdhD)
   00650 Butanoate metabolism
    SG0716 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SG0716 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAR36612
UniProt: B5R684
Position
776131..776478
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFAASGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYIKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccgcgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacattaaaccactggcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system