KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0720Help
Entry
SG0720            CDS       T00770                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00020  Citrate cycle (TCA cycle)
seg00310  Lysine degradation
seg01100  Metabolic pathways
seg01110  Biosynthesis of secondary metabolites
seg01120  Microbial metabolism in diverse environments
seg01130  Biosynthesis of antibiotics
seg01200  Carbon metabolism
Module
seg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SG0720 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SG0720 (sucB)
Enzymes [BR:seg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SG0720 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: CAR36616
UniProt: B5R688
Position
782317..783525
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASVDGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAVEPAAQPALGARGEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYVKAVV
EALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcgaccgtc
gccacctggcataaaaaaccgggtgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagtggacggcattctggatgcggtt
ctggaagaggaggggacgactgtcacctctcgccagatcctgggtcgcctgcgtgaaggc
aacagcgcgggtaaagagaccagcgccaaatctgaagagaaagcgtctacgccggcacag
cgccagcaggcgtcgctggaagaacaaaacaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacaatctggaagccagcgccattaaaggcactggtgtgggtgggcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaaggcgagtctaaagcacccgctgtt
gaacctgcagcacaacccgctctgggcgcgcgcggcgaaaaacgcgtgccaatgacccgc
ctgcgcaagcgcgtggccgagcgtctgctggaagcgaaaaattctaccgccatgctgacg
accttcaatgaagtcaacatgaagccgattatggatttgcgtaagcagtatggcgaagtg
tttgaaaaacgtcatggtatccgcctgggctttatgtccttctacgtgaaagcggtagtg
gaagcgctgaagcgttatccggaagtgaacgcctctatcgacggcgatgacgtggtgtac
cacaactactttgatgtgagcatggcggtgtctacgccgcgcggcctggtcacgccggtc
ctgcgtgacgtggatacgctgggcatggctgacattgagaaaaaaattaaagaactggct
gtcaaaggccgcgacggcaagctgaccgtagaagacctgaccggcggtaactttaccatt
accaacggcggcgtattcggttcgctgatgtctaccccgatcatcaacccgccgcagagc
gcgattctgggaatgcatgctattaaagacaggccgatggcggtggatggcaaggtggaa
atcctgccgatgatgtacctggcgctctcttacgatcatcgcctgatcgatggtcgcgaa
tccgtgggcttcctggtcaccatcaaagagttgctggaagatccgacccgtctgctgttg
gacgtgtag

DBGET integrated database retrieval system