KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0764Help
Entry
SG0764            CDS       T00770                                 

Gene name
ybhC
Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:seg00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:seg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(827329..828645)
Genome map
AA seq 438 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAARYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAVDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRRAVNPGGKYMPGKPAWY
MFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNGYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVAKPWADAVINVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDTNYNRM
WEYNNRGVGSKVVAEPKQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcagatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgcccaattctgtcggcaaatgaagcgaaaaacttcgttgcggcgcgctattttgcc
tccctgacgccgaataccgccccgtggtcgccgtcgccgattaccctgcccgcacagcct
gactttgtggtggggccggcaggtacgccaggcgttacgcacacctcgattcaggccgcg
gtcgatgcggcaatggttaaacgcacgaacaaacgccagtacattgctattatgccgggc
gactatcaggggaccgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggacc
ggtgaaaaaccgatcgatgtgaaaattgggatggcgattgatggtgaaatgagcgtcgct
gactggcgccgcgcggtgaatcccggcgggaaatatatgcctggtaaacccgcctggtat
atgttcgataactgccaaagcaaacacgccgcgacgatcggtgtgatgtgttctgccgcg
ttctggtcgcagaataacggtctgcagctacaaaatctgaccatcgagaacacgctaggc
gacagcgtcgatgccggaaaccatccggcggtggcgttgcgtaccgatggcgacaaagtc
cagattaacaaggtcaatatccttggccgccagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaaaccgatcgccagccgcgtacgctggtgacgaacggctatatt
gaaggcgatgtggatatggtttccggacgcggcgccgtggtgttcgataacaccaacttc
caggtcgtcaactcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtcc
aatatttactatggctttttggcgatcaacagccgctttaacgcctccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgccaacaccaacggtcaggtcgtgatccgc
gacagcgtgattaacgagggcttcaacgttgccaaaccgtgggccgacgcggtcatcaac
gttgccaaaccgtgggccgacgcggtcatctcgaaacgtccgtttgctggaaatacgggg
accgtggatgacaaagacgaggtgcagcgtaatctgaacgacactaactacaaccgcatg
tgggaatacaacaaccgcggtgtaggcagtaaagtagtggcggaacctaagcagtaa

DBGET integrated database retrieval system