KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1338Help
Entry
SG1338            CDS       T00770                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148 2.7.1.-)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:seg00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1403218..1404069)
Genome map
AA seq 283 aa AA seqDB search
MMTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRRDGEIHLLTPVTGV
ENEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSIDELTTLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIP
TPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacag
cgtgcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacaca
ctccacatcgaaccgcgtcgcgatggcgaaatccatttattaacgccggtaaccggcgtt
gaaaatgaagacaacctgatcgtccgcgccgcgcggctgttgatgaaagtcgcctcggag
agtggacgcctgcccgccggaagcggcgcggatatcagcattgagaagcgccttcccatg
ggcggcggtctgggcggcggctcgtctaacgccgcgaccgttctggtggcgctcaatcat
ctttggcaatgcgggctttccattgatgaactgacgacgctcggcctgacgctcggcgcc
gacgtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatatta
acgccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccg
acgccggttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagat
acgttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaa
gccccggaatggctcaatgcttttgtggcgaagggtgtcaacctttccccattgcatcga
gagttactctaa

DBGET integrated database retrieval system