KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1364Help
Entry
SG1364            CDS       T00770                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SG1364 (galU)
   00052 Galactose metabolism
    SG1364 (galU)
   00500 Starch and sucrose metabolism
    SG1364 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SG1364 (galU)
Enzymes [BR:seg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SG1364 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1431889..1432797
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGNEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGNSQIMVEPVEDVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWALLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNSLGAEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattcgaaagtcaaaaaagccgttatcccggtcgcgggattgggaacc
aggatgctgccagcgaccaaagctatcccgaaagagatgctgccgctggttgataagcca
ttaattcagtacgtcgtgaacgaatgtatcgctgctggcattactgaaatcgtgcttgtt
acgcactcgtctaaaaactctattgaaaaccactttgataccagttttgagctggaagcg
atgctggaaaaacgcgttaagcgtcagcttctggaggaggttcagtctatttgccctccg
catgtcactattatgcaggtacgtcaagggctggcaaaaggcctgggccatgccgtattg
tgcgcgcatcccgttgtcggaaacgaacctgtcgctgttattctgccagacgttattctt
gacgaatatgagtccgacctgtctcaggataacctggctgaaatgatccgccgtttcgat
gaaaccggcaatagccagattatggttgagccagtagaagatgtgactgcatacggcgtg
gtcgattgtaaaggcgttgagctggcaccgggcgaaagtgtgccgatggttggcgtggtt
gaaaaaccaaaagcggatgtcgcgccgtctaaccttgcgattgtcgggcgttatgtgttg
agcgcggatatctgggcgttgctggcgaaaacccctccgggcgccggggatgaaattcag
ttgaccgatgctatcgatatgctgatcgaaaaagaaacggttgaagcctaccacatgaag
ggtaaaagccatgactgtggtaataagttaggatatatgcaggcattcgttgaatatggc
atccgtcataattcgctgggtgctgaatttaaagcctggcttgaagaagaaatgggtatt
aagaagtaa

DBGET integrated database retrieval system