KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1560Help
Entry
SG1560            CDS       T00770                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SG1560 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG1560 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SG1560 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SG1560 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SG1560 (adhP)
   00626 Naphthalene degradation
    SG1560 (adhP)
Enzymes [BR:seg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SG1560 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1635597..1636517)
Genome map
AA seq 306 aa AA seqDB search
MLKMECCGVCHTDLHVKNGDFGDKTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYE
GCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEECIVVADYAVKVPEGLDSAAASSITCAG
VTTYKAVKISHIKPGQCIAIYGLGNLALQYAKNVFNAKVIAIDVNDGQLKLAEEMGADLT
INSRTEDAAKIVQEKTGGAHAAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPEAMNLDIP
RLVLDGIQVVGSLVGTRQDLTEAFQFAAEGKVVPKVALRPLEDINVIFKEMEQGQIRGRM
VIDFRR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaaatggagtgctgcggcgtatgccataccgatctacacgtgaaaaacggcgat
ttcggtgacaaaaccggcgtcattctgggacacgaaggcattggcgtcgtggcggaagtc
ggtcctggtgtcacctcgctgaaacccggcgatcgcgcgagtgtcgcgtggttttatgaa
ggatgcggacactgtgagtattgcaatacgggcaatgaaaccttatgccgcaacgtgaaa
aatgccggttacacggtagatggcggcatggccgaagagtgtattgtcgtcgcggattat
gcggtgaaagtaccggaaggtctggactctgcggcggcaagtagtattacctgcgcgggc
gttaccacgtataaagcggtgaagatttctcatattaaacctggccagtgtattgccatc
tacggtctgggtaatctggccttgcagtacgcgaaaaacgttttcaatgcgaaagtgatc
gccattgatgtcaatgatggacaactgaaactggccgaggaaatgggcgcagatctgacc
attaattcacgtacggaagatgcggctaaaattgtgcaggaaaaaaccggtggcgcgcac
gcagcggtggttaccgcggtcgctaaggcggcgtttaattccgcagtagatgccgttcgc
gccggaggtcgcgtggtggcagtcgggctgccgccagaagccatgaaccttgatatccct
cgcctggtgctggatggaattcaggttgtcggttcgttggtggggacacgccaggatctg
accgaagccttccagttcgcggcggaaggaaaagtcgtgccaaaagtcgctttacgtccg
cttgaagatatcaacgttatttttaaagagatggaacaagggcaaattcgtggccgtatg
gtcatcgatttccgtcgttaa

DBGET integrated database retrieval system