KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG1790Help
Entry
SG1790            CDS       T00770                                 

Gene name
pfkB
Definition
6-phosphofructokinase 2
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG1790 (pfkB)
   01230 Biosynthesis of amino acids
    SG1790 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG1790 (pfkB)
   00030 Pentose phosphate pathway
    SG1790 (pfkB)
   00051 Fructose and mannose metabolism
    SG1790 (pfkB)
   00052 Galactose metabolism
    SG1790 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SG1790 (pfkB)
Enzymes [BR:seg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SG1790 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1863126..1864058
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgcaattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaagactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcacagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgccgcgctggcgcttggcgat
atcgaactggtgaaacctaacctgaaagaattgagcgcgttggttaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtgggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgctttggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttcccgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system