KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG2230Help
Entry
SG2230            CDS       T00770                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00790  Folate biosynthesis
seg01100  Metabolic pathways
Module
seg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SG2230 (folE)
Enzymes [BR:seg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SG2230 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAR38064
UniProt: B5RC32
Position
complement(2284832..2285500)
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPPMDELDNETRKSLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDYVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHP
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccgcctatggatgaactggataatgaaacgcgaaaaagccttatc
gcagggcatatgactgagattatgcagttgctgaatctcgatttgagcgatgacagtctg
atggaaacgccgcatcgtatcgctaagatgtacgttgacgagattttcgccggcctcgac
tatgccaatttcccgaaaattaccctcattgaaaataaaatgaaggtggatgaaatggtc
accgtccgcgatatcacgctgaccagcacctgtgaacatcacttcgtgaccattgatggc
aaagcgaccgtcgcgtatatccccaaagattacgtgatcggcctgtcgaaaattaaccgc
atcgtgcaattcttcgcccagcgtccacaggttcaggaacgtttgacccaacaaattctg
acggcgctgcaaaccttgctcggcaccaataatgtagcggtatcgattgatgcggtgcat
tactgcgtgaaagcgcgcggtattcgtgacgcaaccagcgccacgacgacgacgtcgctg
ggtggattgtttaagtccagccagaatacgcgccaggagtttctgcgtgccgttcgccat
catccatga

DBGET integrated database retrieval system