KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG2304Help
Entry
SG2304            CDS       T00770                                 

Gene name
ubiG
Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00130  Ubiquinone and other terpenoid-quinone biosynthesis
seg01100  Metabolic pathways
seg01110  Biosynthesis of secondary metabolites
Module
seg_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SG2304 (ubiG)
Enzymes [BR:seg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     SG2304 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     SG2304 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 Ubie_methyltran CMAS NodS MTS Methyltransf_9 PrmA MetW Methyltransf_32 Sterol_MT_C TPMT DREV GidB DUF4390
Motif
Other DBs
NCBI-ProteinID: CAR38135
UniProt: B5RCA1
Position
2365250..2365978
Genome map
AA seq 242 aa AA seqDB search
MNTEKPSVAHNVDHNEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYITERSGGLFGKKV
LDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIEVEYMQETVEEHAAKHA
QQYDVVTCMEMLEHVPDPQSVVHACAQLVKPGGEVFFSTLNRNGKSWLMAVVGAEYILRM
VPKGTHDVKKFIKPAELLSWVDETVLKEQHITGLHYNPITNTFKLGPGVDVNYMLHTRAK
KA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgaaaaaccgtcggtagctcacaacgttgaccataatgaaatcgccaaattc
gaagccgtcgcgtcgcgctggtgggatctggagggcgaattcaagccattgcatcgtatc
aaccccctacgccttggctacattactgagcgctcaggcggcctgtttggtaaaaaggtg
ctcgacgtcggctgtggcggcggtattctggcggagagcatggcgcgcgaaggcgcaacc
gtcaccgggctggatatgggctttgagcctttgcaggtcgccaaactgcatgcgctggaa
agcggcatcgaggtagagtacatgcaggagacggttgaggaacatgcggcaaaacacgcc
cagcaatacgacgtcgtcacctgtatggaaatgctggagcacgttcccgatccgcaatcg
gtcgtccacgcctgcgcccaactggttaaacccggcggcgaggtgttcttctcaacgttg
aaccgcaatgggaaatcctggctgatggcggtcgtcggcgctgagtatattctgcgcatg
gtgccaaaaggcacgcacgacgtgaagaaattcattaagcctgctgaactgttaagctgg
gtagatgaaaccgtcctgaaagagcaacatatcaccgggctgcactacaacccgataacc
aatactttcaaactcggtcccggagtagacgttaactacatgttgcatacccgcgctaaa
aaagcctga

DBGET integrated database retrieval system