KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG2618Help
Entry
SG2618            CDS       T00770                                 

Gene name
rnc
Definition
ribonuclease III (EC:3.1.26.3)
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2716401..2717081)
Genome map
AA seq 226 aa AA seqDB search
MNPIVINRLQRKLGYTFNHQELLQQALTHRSASSKHNERLEFLGDSILSFVIANALYHRF
PRVDEGDMSRMRATLVRGNTLAELAREFDLGECLRLGPGELKSGGFRRESILADTVEALI
GGVFLDSNIQTVEQLILNWYKTRLDEISPGDKQKDPKTRLQEYLQGRHLPLPSYLVVQVR
GEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQALKKLELE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccatcgtaattaatcggcttcaacggaagctgggctacacttttaatcatcag
gagctgttgcagcaggcattaactcaccgcagcgccagcagtaaacataacgaacgcctg
gaatttttaggcgattcaatcctgagcttcgttatcgctaacgcgctttatcaccgtttt
ccacgggtggatgagggagatatgagccgtatgcgcgccacgttggtacgtggtaatacg
ctggcggaattagcccgtgaatttgatttaggcgagtgcctgcgtttagggccgggcgaa
ttaaaaagcggcggattccgtcgagagtccattctggcggacaccgtggaagcgttaatc
ggcggagtatttctcgatagcaatatccagaccgtcgagcagttaatccttaactggtat
aaaacccgtctggatgagataagcccgggcgataaacaaaaagatcctaaaacgcgcttg
caggagtatttgcagggtcgccatctgccgctgccatcttacctggttgtgcaggtacgc
ggcgaggcgcacgatcaggaatttactatccactgccaggtcagcggcctgagcgaaccg
gtggttggcacgggttccagccgtcgtaaggcggagcaggctgccgccgaacaggcgctg
aaaaaactggagttggaatga

DBGET integrated database retrieval system