KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG2655Help
Entry
SG2655            CDS       T00770                                 

Gene name
ffh
Definition
signal recognition particle protein
Orthology
K03106  
signal recognition particle subunit SRP54
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:seg03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:seg03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2760182..2761543)
Genome map
AA seq 453 aa AA seqDB search
MFDNLTDRLSRTLRNISGRGRLTEDNVKETLREVRMALLEADVALPVVREFINRVKEKAV
GHEVNKSLTPGQEFVKIVRSELVAAMGEENQTLNLAAQPPAVVLMAGLQGAGKTTSVGKL
GKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFFPSDVGQKPVDIVNAALKEAK
LKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIKPVETLFVVDAMTGQDAANTAKAFNEAL
PLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTDALEPFHPDRIASRILGMGDV
LSLIEDIESKVDRAQAEKLATKLKKGDGFDLNDFLEQLKQMKNMGGMASLMGKLPGMGKI
PDNVKSQMDDKVLVRMEAIINSMTLKERAKPEIIKGSRKRRIAQGCGMQVQDVNRLLKQF
DDMQRMMKKMKKGGMEKMMRSMKGMMPPGFPGR
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatttaaccgatcgtttgtcgcgcacgctgcgcaatatcagtggccgtggg
cgccttactgaagacaacgttaaagagacgctgcgcgaagtgcgcatggcgctgctggag
gctgacgttgcgctgccggtagtgcgtgagttcatcaatcgcgtaaaagagaaagcggtt
ggtcatgaagttaacaagagcctgaccccagggcaggagttcgtcaagattgtccgtagc
gaactggttgcggcgatgggcgaagagaaccagacgctgaatttagctgcgcagccgcca
gccgtagtattgatggcgggtctgcagggggcgggtaaaaccaccagcgtcggtaagttg
ggtaaattcttgcgcgagaagcacaagaagaaagtgctggtcgtctctgccgacgtctat
cgcccggcggcgatcaaacagctcgaaacgctggctgaacaggttggcgtggatttcttc
ccgtctgatgtcggccagaaaccggttgatatcgtcaacgccgcgctgaaagaagcgaag
ctcaaattctacgacgtgctgctggtggataccgccggtcgtctgcacgttgacgaagcg
atgatggacgaaatcaaacaggtccacgcttctatcaagccagtagaaacgctgtttgtc
gtcgatgcgatgaccggtcaggatgcggcgaataccgcaaaagcctttaacgaagcgctg
ccgttaaccggcgtggtgctgaccaaagttgatggtgatgctcgtggcggtgcggcgctc
tctattcgtcatatcaccggcaagccgattaaattcctcggtgtcggcgagaaaaccgac
gcgctggaaccgttccacccggatcgtatcgcctcgcgtattctcggtatgggcgacgta
ctgtctcttatcgaagatatcgaaagcaaagttgaccgcgcacaggctgaaaagctggcg
actaaactgaagaaaggcgacggtttcgacctgaacgacttcctggaacagctcaaacag
atgaaaaacatgggcggtatggccagtctgatgggcaaattaccgggcatggggaagatt
ccggacaacgttaaatcgcagatggatgacaaggtgctggtgcgtatggaagcgatcatc
aattcgatgacgctgaaagagcgcgcgaagccggaaatcatcaaaggttcccgcaagcgt
cgtatcgcgcagggctgtgggatgcaggtgcaggacgttaaccgccttctgaaacagttc
gacgacatgcagcgcatgatgaagaagatgaagaagggcgggatggagaagatgatgcgc
agtatgaaggggatgatgccgccaggcttcccgggtcgctaa

DBGET integrated database retrieval system