KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG2938Help
Entry
SG2938            CDS       T00770                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Brite
Enzymes [BR:seg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SG2938 (dsbC)
Secretion system [BR:seg02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SG2938 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3069061..3069723)
Genome map
AA seq 220 aa AA seqDB search
MAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSG
AHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGI
TVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDMNIADHYALGVQ
LGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtggcccatgcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagt
acggaaattcaggcctcgccagtggcagggatgaaaaccgtcctcactcacagcggcgta
ctgtacgtcactgatgacggcaaacatattattcaagggccgatgtatgacgtgagcggc
gcgcatccggtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaa
gagatgatcgtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatc
acctgcggctattgtcataagctacatgaagagatgaaagattataacgcgctggggatc
acggtacgttatctggccttcccgcgccaggggctggaaagccaggcggagcaggatatg
aaatctatctggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaag
ggcgtgaaaccggcaagctgtgacatgaacattgctgatcattatgcgttgggcgtgcag
ttgggcgtcagcggtacgccagccattgtattgagtaacggctatgtggtgcctggctat
cagggaccgaaagagatgaaagcgtttcttgatgagcatcaaaaacagaccagtggtaaa
taa

DBGET integrated database retrieval system