KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3110Help
Entry
SG3110            CDS       T00770                                 

Gene name
yqjH
Definition
hypothetical protein
Orthology
K07229  
ferric-chelate reductase (NADPH) [EC:1.16.1.9]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Brite
Enzymes [BR:seg01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.9  ferric-chelate reductase (NADPH)
     SG3110 (yqjH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3244489..3245256)
Genome map
AA seq 255 aa AA seqDB search
MTTSSVRYPQRVRNELRFRELIVLRVERISAGFQRIVLGGEALDGFISLGFDDHTKVFFP
EPGCRFTPPTVTEEGIIWGEGVRPVSRDYTPLYDEARRELALDFFIHDGGVASRWAMEAR
EGDTLTIGGPRGSLVVPEEYACQVYVCDESGMPALRRRLESLSRLPVRPAVTALVSIQDA
AYRDYLAHLTDITVEYVVGGDEQAMQTRLSQLTIPESDYFIWITGEGKTVKRLSQCFEKG
FDPHLVRAAAYWHRK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatcatccgtacgctacccacagcgtgttcgtaatgagctgcgttttcgcgag
ctgatcgttctgcgggtagaacgtattagcgcaggatttcagcggatcgtacttggcggc
gaggcgctggacggtttcatctccctgggctttgacgatcacacgaaagtttttttccct
gagccaggctgtcgctttacgcctccgacagtcactgaggaaggcattatctggggggag
ggcgttcgcccggtctccagggattacacgccgctgtatgacgaggcgcgtcgcgagctg
gcgctggatttctttatccacgatggcggcgtagccagccgttgggcaatggaagcccgt
gaaggcgatacactgacgatcggcgggccgcgcggttcgctggtggtgccggaagagtat
gcctgtcaggtttatgtctgcgatgagtccggtatgcctgcgctacgtcgtcgtctggaa
tcgcttagccgtctgcctgtgcgccctgcggtaaccgcgctggtgagcattcaggatgcg
gcataccgcgattatctcgcccatttgacggatattactgtggaatatgttgttggcggc
gatgaacaggcaatgcaaacgcgcctgtcgcagctgacaataccagaatcagactatttc
atctggattactggcgaaggcaaaacggtaaaacgtttaagtcagtgctttgaaaagggg
tttgatccacacctggtacgtgcggcagcctattggcatcgtaaatag

DBGET integrated database retrieval system