KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3334Help
Entry
SG3334            CDS       T00770                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SG3334 (glpK)
Enzymes [BR:seg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SG3334 (glpK)
Exosome [BR:seg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SG3334 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3490571..3492079
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTADICEQLKRDG
LEDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRAMAWEEHDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtc
gttatggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttat
cctaagccaggctgggtagaacacgacccgatggaaatttgggcgtcccaaagctcaacg
ctggtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatc
accaaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaac
gctattgtctggcagtgccgtcgtaccgccgatatttgcgaacagcttaaacgcgacggc
ctggaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcact
aaagtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgag
ctgctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccac
gttacggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgg
gacgataagatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaag
tcctccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatc
gccgggattgccggggatcagcaggccgcgctattcggccaactgtgcgtaaaggaagga
atggcaaagaatacctacggcaccggctgctttatgctgatgaacaccggcgagaaagcg
gtaaaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaac
tatgcgctggaaggcgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaa
atgaagctcatcagcgacgcgttcgactccgaatatttcgccacgaaagtgaaagatacc
aacggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggacccgtat
gcccgcggcgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgcg
acgctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactcc
ggtatccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatg
cagttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgacc
gcgctgggcgccgcctatctggctggcctggccgtcggttactggcagaacctggacgag
ctgcaggaaaaagccgtcattgagcgagaattccgccccggcattgaaaccaccgagcgt
aactaccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcac
gacaagtaa

DBGET integrated database retrieval system