KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3339Help
Entry
SG3339            CDS       T00770                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG3339 (tpiA)
   01230 Biosynthesis of amino acids
    SG3339 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG3339 (tpiA)
   00051 Fructose and mannose metabolism
    SG3339 (tpiA)
   00562 Inositol phosphate metabolism
    SG3339 (tpiA)
Enzymes [BR:seg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SG3339 (tpiA)
Exosome [BR:seg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SG3339 (tpiA)
  Exosomal proteins of bladder cancer cells
   SG3339 (tpiA)
  Exosomal proteins of melanoma cells
   SG3339 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3495388..3496155
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactggcgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaagatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgaactgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtatgcgcacgccagatcgacgcggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttacgaacccgtatgggcgatcggtaccggtaaatctgcaacgcct
gcgcaggcgcaggcagtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggtcattatccagtacggcggttctgttaatgcctccaacgcagccgaa
ctgttcgcgcagccggacatcgacggcgcgctggtaggcggcgcttctctgaaagctgac
gccttcgccgtgatcgtgaaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system