KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3469Help
Entry
SG3469            CDS       T00770                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG3469 (fadB)
   01212 Fatty acid metabolism
    SG3469 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SG3469 (fadB)
   00650 Butanoate metabolism
    SG3469 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SG3469 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SG3469 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SG3469 (fadB)
   00310 Lysine degradation
    SG3469 (fadB)
   00380 Tryptophan metabolism
    SG3469 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SG3469 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SG3469 (fadB)
   00281 Geraniol degradation
    SG3469 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SG3469 (fadB)
Enzymes [BR:seg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SG3469 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SG3469 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SG3469 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     SG3469 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3638333..3640522
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALK
IGLVDGVVKQEKLIEGAIAVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPMTAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDIETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
ETVLASNTSTIPIGELASALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVDDLLASVSQTKRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTQGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGSLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagcctcggc
caggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgctctaat
aaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctcgtcccc
gaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctggaagat
ttacccgtaccgacccttgccgccgtaaacggctatgcgttgggcggcgggtgcgaatgc
gtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccggaaact
aaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctgggcgca
gacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcgctgaaa
atcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgatagcggtg
ttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaactggaa
ccgttgaaactcagtaagattgaagcggcgatgagctttaccatcgctaaaggcatggtc
gcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccattgaagcc
gccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgttccgctg
gcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatatgtaaaa
ggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagcagtactgggc
gcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccggtcatc
atgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaagctgctg
aacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatttcgacc
atacacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaagcggta
gtcgaaaatccgaaagtgaaaaaagcggtactggcggaaaccgagcagaaagtgcgcccg
gaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagcgccctg
gaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatgccgctg
gttgaaatcattcgcggcgagaagagttcagacgaaaccatcgccaaagtcgtcgcctgg
gccagcaaaatgggcaagacgccgattgtagtcaacgactgccccggcttctttgttaac
cgcgtgttattcccctatttcgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatctg
ctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggcaggcttc
ccacaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgccagccgt
tttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggtaagccg
aagaaagaagaagatgctgcggtggatgacctgctggcaagcgtcagtcagacgaaacgc
gacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaagtggtt
cgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacagggcagc
gcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaagtgccg
gaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaaccagcc
cgtccggttggttctctgaaaacggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system