KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3572Help
Entry
SG3572            CDS       T00770                                 

Gene name
glmS
Definition
(GenBank) glucosamine--fructose-6-phosphate aminotransferase
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Insulin resistance
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SG3572 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SG3572 (glmS)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    SG3572 (glmS)
Enzymes [BR:seg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     SG3572 (glmS)
Peptidases [BR:seg01002]
 Cysteine Peptidases
  Family C44
   SG3572 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3757773..3759602
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEANAHPHVSEHIVVVHNGIIENHEPLREALKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDTRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDNTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGEVDLSELGPNADDLLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
ARLKGLDTSIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFADQDAGFVSNDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgttggcgctatcgcgcagcgtgatgtagctgaaatccttctcgaaggt
ttacgtcgtctggaataccgcggatatgactctgccggtctggccgtggtggatgcagaa
ggtcatatgacccgcctgcgtcgcctcggtaaagtccagatgctggctcaggcagcggaa
gaacatcctctgcatggcggcactggtattgctcacactcgctgggcgacgcacggtgaa
ccttcagaagctaacgcgcatccgcatgtttctgaacacattgtggtggtgcataacggc
atcatcgaaaaccatgaaccgctgcgtgaagcgttaaaagcgcgtggctataccttcgtt
tctgaaaccgacaccgaagtgattgcacacctggtaaactgggaactgaaacagggcggt
actctgcgtgaggctgttctgcgtgctatcccgcaactgcgtggtgcgtacggtacagtg
atcatggatacccgtcacccggataccctactggcggcacgttctggtagcccgctggtg
attggcctgggtatgggcgaaaactttatcgcttctgaccagctggcgctgttgccagtg
actcgtcgctttatcttccttgaagagggcgatatcgctgaaatcactcgccgttcggta
aatatcttcgataacaccggcgcggaagtaaaacgtcaggatatcgaatctaatctgcaa
tatgacgcgggcgataaaggtatttaccgccactacatgcagaaagagatctacgaacag
ccgaacgcgatcaaaaacacccttaccgggcgcatcagccacggtgaggtggatttaagc
gagctgggaccgaacgccgatgatctgttgtcgaaggttgagcatattcagatcctcgcc
tgcggtacgtcttacaactccggtatggtttcccgttactggtttgaatcgctggcaggt
attccgtgcgacgttgaaatcgcctctgaattccgctatcgcaaatctgccgtgcgccgt
aacagcctgatgatcacgctctcccagtctggcgaaacggcagataccctggctggcctg
cgtctgtcgaaagagctgggatatttgggctctctggccatttgtaacgtgccgggatct
tcgctggtgcgtgaatccgatctggcgctgatgaccaacgcgggtacggaaattggcgta
gcatctaccaaagccttcaccacccagttaaccgtgctgttgatgctggtggcgaaactg
gcgcgtctgaaaggtctggatacgtccattgagcatgatatcgttcatggcctacaggcg
ctgccgagccgtattgagcagatgctgtcgcaggacaaacgtatcgaagccctggcggaa
gatttctctgacaaacaccatgcgctgttcctggggcgtggcgatcaatatccgattgcg
ctcgaaggcgcgctgaagctgaaagagatctcttacattcacgcggaagcctatgctgca
ggcgagctgaaacacgggccgttggcgctgattgacgccgatatgccggtgattgtggtg
gcgccgaacaacgaactgctggagaaactgaaatccaacatcgaagaagttcgcgcacgt
ggcggtcagttgtacgtcttcgccgatcaggatgcgggtttcgtcagcaacgacaacatg
cacatcatcgagatgccgcatgtggaagaggtcattgcgcctatcttctacaccgttccg
ctgcaactgctggcgtatcacgtggcgctgattaaaggcaccgacgttgaccagccgcgt
aacctggcgaaatcggttaccgtagagtaa

DBGET integrated database retrieval system