KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3572Help
Entry
SG3572            CDS       T00770                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:seg00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:seg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3757773..3759602
Genome map
AA seq 609 aa AA seqDB search
MCGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAE
EHPLHGGTGIAHTRWATHGEPSEANAHPHVSEHIVVVHNGIIENHEPLREALKARGYTFV
SETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDTRHPDTLLAARSGSPLV
IGLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDNTGAEVKRQDIESNLQ
YDAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGEVDLSELGPNADDLLSKVEHIQILA
CGTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGL
RLSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKL
ARLKGLDTSIEHDIVHGLQALPSRIEQMLSQDKRIEALAEDFSDKHHALFLGRGDQYPIA
LEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRAR
GGQLYVFADQDAGFVSNDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQPR
NLAKSVTVE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgttggcgctatcgcgcagcgtgatgtagctgaaatccttctcgaaggt
ttacgtcgtctggaataccgcggatatgactctgccggtctggccgtggtggatgcagaa
ggtcatatgacccgcctgcgtcgcctcggtaaagtccagatgctggctcaggcagcggaa
gaacatcctctgcatggcggcactggtattgctcacactcgctgggcgacgcacggtgaa
ccttcagaagctaacgcgcatccgcatgtttctgaacacattgtggtggtgcataacggc
atcatcgaaaaccatgaaccgctgcgtgaagcgttaaaagcgcgtggctataccttcgtt
tctgaaaccgacaccgaagtgattgcacacctggtaaactgggaactgaaacagggcggt
actctgcgtgaggctgttctgcgtgctatcccgcaactgcgtggtgcgtacggtacagtg
atcatggatacccgtcacccggataccctactggcggcacgttctggtagcccgctggtg
attggcctgggtatgggcgaaaactttatcgcttctgaccagctggcgctgttgccagtg
actcgtcgctttatcttccttgaagagggcgatatcgctgaaatcactcgccgttcggta
aatatcttcgataacaccggcgcggaagtaaaacgtcaggatatcgaatctaatctgcaa
tatgacgcgggcgataaaggtatttaccgccactacatgcagaaagagatctacgaacag
ccgaacgcgatcaaaaacacccttaccgggcgcatcagccacggtgaggtggatttaagc
gagctgggaccgaacgccgatgatctgttgtcgaaggttgagcatattcagatcctcgcc
tgcggtacgtcttacaactccggtatggtttcccgttactggtttgaatcgctggcaggt
attccgtgcgacgttgaaatcgcctctgaattccgctatcgcaaatctgccgtgcgccgt
aacagcctgatgatcacgctctcccagtctggcgaaacggcagataccctggctggcctg
cgtctgtcgaaagagctgggatatttgggctctctggccatttgtaacgtgccgggatct
tcgctggtgcgtgaatccgatctggcgctgatgaccaacgcgggtacggaaattggcgta
gcatctaccaaagccttcaccacccagttaaccgtgctgttgatgctggtggcgaaactg
gcgcgtctgaaaggtctggatacgtccattgagcatgatatcgttcatggcctacaggcg
ctgccgagccgtattgagcagatgctgtcgcaggacaaacgtatcgaagccctggcggaa
gatttctctgacaaacaccatgcgctgttcctggggcgtggcgatcaatatccgattgcg
ctcgaaggcgcgctgaagctgaaagagatctcttacattcacgcggaagcctatgctgca
ggcgagctgaaacacgggccgttggcgctgattgacgccgatatgccggtgattgtggtg
gcgccgaacaacgaactgctggagaaactgaaatccaacatcgaagaagttcgcgcacgt
ggcggtcagttgtacgtcttcgccgatcaggatgcgggtttcgtcagcaacgacaacatg
cacatcatcgagatgccgcatgtggaagaggtcattgcgcctatcttctacaccgttccg
ctgcaactgctggcgtatcacgtggcgctgattaaaggcaccgacgttgaccagccgcgt
aacctggcgaaatcggttaccgtagagtaa

DBGET integrated database retrieval system