KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3613Help
Entry
SG3613            CDS       T00770                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3804299..3805636
Genome map
AA seq 445 aa AA seqDB search
MSGYVWYYDKQRSKKSDVQASVVGENNKILGYFREKGCDYCHTPSAELPFYSSFPVAKQL
MDYDIQLGYKSFNLEAVRAALIADTPVPQSELNKIEWVMQHQTMPPTRYVALHWAGGVSD
KERTDILNWIADQRERNYASADTDPAHRNEPVQPIPRNIPVDAKKVDLGFRLYHDERLSG
DSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVFNSVFNIEQFWDGRAATLQEQA
GGPPLNPIEMASKSWDEIISKLDKEPALKKDFQAVYPQGFTGENITDAIAEFEKTLITPD
SAFDKWLRGDENALTAQQKHGYQLFKENKCATCHGGIILGGRSFEPLGLKRDFNFGEITA
ADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVPTLDGAVKLMLRYQVGTDLPQN
DIDDIVAFLESLTGVYTPYQPEYAQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgggtatgtatggtattacgacaaacagcgcagtaaaaaaagcgatgtgcaggcc
tcggttgtgggtgaaaataataaaatactgggttatttcagggagaaaggatgtgattat
tgtcatacgccttccgctgaattgcctttttattcctcttttccggtggcaaagcagtta
atggattacgatatccagctcggttacaagtcgtttaacctggaggcggtacgggccgcc
ctgattgcggatacgccggtgccgcaaagcgaactgaataaaattgaatgggttatgcaa
catcagactatgccgccaacccgctatgtcgcgctgcactgggcggggggcgtcagcgat
aaagagcgtactgacatcctgaactggatagccgatcagcgtgagcgcaactatgccagc
gccgataccgaccccgcgcaccggaatgaacccgttcagcctattccgcgcaatattccc
gtcgatgcgaaaaaagtcgacttaggtttccgtctttatcatgatgaacgtttatccggc
gacagcacaatatcctgtgcgcattgtcacgcgttaaatgcgggtggtgtcgatggcaga
aaaacctcaattggcgttggcggcgcggtaggaccaataaatgcgccgacggtattcaac
tccgtatttaatatcgaacaattttgggatggtcgtgctgcaaccctgcaggagcaagca
ggcggaccaccgttaaatcctattgaaatggcctctaaatcctgggatgaaattattagc
aagcttgataaagagcctgccctgaaaaaagatttccaggcggtttatccgcaaggattt
accggggaaaatattactgatgcgatcgccgaatttgaaaaaacgttgataacgccggat
tccgcctttgataaatggctacgtggagatgaaaatgcgctgaccgcgcaacagaaacac
ggttatcaattatttaaagagaataaatgtgcaacctgtcacggcggtatcattttaggc
gggcgctcttttgaaccattgggattaaagcgagactttaattttggcgaaattaccgca
gcggatattggtcgtatgaacgtcaccaaagaggttcgcgataaattacggcaaaaagtc
ccgggcttacgcaacgtcgcgttaacagcgccttatttccatcggggcgacgtaccgacg
ctggatggcgcggtaaaactgatgctgcgttatcaggttggcaccgatctgccgcaaaac
gatattgacgatatcgtcgccttcctggaaagcctgaccggtgtttatacgccatatcaa
cctgaatatgcgcaatga

DBGET integrated database retrieval system