KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG3705Help
Entry
SG3705            CDS       T00770                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:seg03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3895792..3896601
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWPVSDEIYRLSDTPVLSVQRRAKYLL
LELPDGWIIIHLGMSGSLRILSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKEL
EGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRHCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccggggtattgaaccccatttagttggc
gctactatcctgcacgcccatatccgtaacggccgtctgcgctggccggtttcagacgaa
atttatcgtctgagcgatacacccgtccttagcgttcagcgtcgtgctaaatatttactg
ctggagctgcctgacggctggataattattcacctggggatgtcgggaagcttgcggata
ttgtcggaagcgctgccggcggaaaagcacgaccatgtcgatttggtgatgagcaacggc
aaaattctacgttataccgatcctcgccgctttggcgcctggttatggaccaaagagctg
gaagggcataacgtactggcgcatctgggaccggagccgctaagcgatgagtttaatggc
gaatatttgcagcagaaatgcgcgaagaagaagacggcgattaaaccctggctgatggat
aacaagctggtggtcggcgtggggaatatctacgccagcgagtcgctgtttgccgctggt
attcaccctgaccgcttggcgtcgtcactctcgacagaggagtgcgacctgctggcacgg
gtgattaaagccgttttgctgcgctctattgaacaaggcgggacaacgctgaaggatttt
ctgcaaagcgatgggaaaccgggctattttgcgcaggagttgcaggtgtacgggcgcaaa
ggcgagccgtgtcgggtatgcggtacgccgatagtcgcaacgaaacacgcacagcgtgcg
acgttctattgccgtcactgtcagaagtaa

DBGET integrated database retrieval system