KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG4249Help
Entry
SG4249            CDS       T00770                                 

Gene name
cysQ
Definition
(GenBank) cysQ protein
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
seg00920  Sulfur metabolism
seg01100  Metabolic pathways
seg01120  Microbial metabolism in diverse environments
seg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:seg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SG4249 (cysQ)
Enzymes [BR:seg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SG4249 (cysQ)
Transfer RNA biogenesis [BR:seg03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SG4249 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: CAR40011
UniProt: B5R9G3
Position
4477795..4478535
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVL
KVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgccagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagccaaaccgatggagtacgcccgcaagcaggacgattctccagtcactgcggcg
gatatcgccgcacataccgtgattctcgaagggttacgcacgctcacgccggatattccg
gtgctttcagaagaagatccgcccgcctgggaagtgcgccagcactggcagcgctactgg
ctggtcgatccgctcgacggcaccaaagagttcatcaagcgcaatggcgaattcacggtc
aatattgcgctgattgagcagggcaagccggtgttgggcgttgtctatgcgccggtgctg
aaagtgatgtactacgcggcggaaggtaaggcctggaaagaggagtgcggggtgcgtaag
cagattcaggtgcgggatgcccgcccgccgctggtggtgattagccgttcgcatacggat
gatgaactcaccgaatatctccaacagcttggcgaacatcagaccacctctattggttcc
tcgctgaaattctgtcttgtggcggaaggccaggcgcagctttaccccagatttgggccg
accagcgtctgggacactgccgcaggtcatgccattgctgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggactatacccctcgtgagtcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system