KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_2176Help
Entry
SPUCDC_2176       CDS       T02824                                 

Gene name
ybhC
Definition
putative pectinesterase precursor
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sega00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sega00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2186530..2187846
Genome map
AA seq 438 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAARYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAVDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRRAVNPGGKYMPGKPAWY
MFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVAKPWADAVINVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDTNYNRM
WEYNNRGVGSKVVAEPKQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcagatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgcccaattctgtcggcaaatgaagcgaaaaacttcgttgcggcgcgctattttgcc
tccctgacgccgaataccgccccgtggtcgccgtcgccgattaccctgcccgcacagcct
gactttgtggtggggccggcaggtacgccaggcgttacgcacacctcgattcaggccgcg
gtcgatgcggcaatggttaaacgcacgaacaaacgccagtacattgctattatgccgggc
gactatcaggggaccgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggacc
ggtgaaaaaccgatcgatgtgaaaattgggatggcgattgatggtgaaatgagcgtcgct
gactggcgccgcgcggtgaatcccggcgggaaatatatgcctggtaaacccgcctggtat
atgttcgataactgccaaagcaaacacgccgcgacgatcggtgtgatgtgttctgccgcg
ttctggtcgcagaataacggtctgcagctacaaaatctgaccatcgagaacacgctaggc
gacagcgtcgatgccggaaaccatccggcggtggcgttgcgtaccgatggcgacaaagtc
cagattaacaaggtcaatatccttggccgccagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaaaccgatcgccagccgcgtacgctggtgacgaacagctatatt
gaaggcgatgtggatatggtttccggacgcggcgccgtggtgttcgataacaccaacttc
caggtcgtcaactcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtcc
aatatttactatggctttttggcgatcaacagccgctttaacgcctccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgccaacaccaacggtcaggtcgtgatccgc
gacagcgtgattaacgagggcttcaacgttgccaaaccgtgggccgacgcggtcatcaac
gttgccaaaccgtgggccgacgcggtcatctcgaaacgtccgtttgctggaaatacgggg
accgtggatgacaaagacgaggtgcagcgtaatctgaacgacactaactacaaccgcatg
tgggaatacaacaaccgcggtgtaggcagtaaagtagtggcggaacctaagcagtaa

DBGET integrated database retrieval system