KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0004Help
Entry
SeHA_C0004        CDS       T00738                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00260  Glycine, serine and threonine metabolism
seh00750  Vitamin B6 metabolism
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01120  Microbial metabolism in diverse environments
seh01230  Biosynthesis of amino acids
Module
seh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeHA_C0004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SeHA_C0004 (thrC)
Enzymes [BR:seh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SeHA_C0004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACF69112
Position
3734..5020
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHELPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAAL
RKLMMTRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caaggactgggcaaacagcagggacttttttttccgcacgaactgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagattctctcg
gcatttattggcgatgaaataccgcagcaaattctggaagagcgcgtccgcgcggcgttt
gcgttcccggcgccggtagcgcaggtagaaagcgatgtcggctgcctggagctgttccat
ggtccgacgctggcctttaaagacttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgacaaaccggtgacgattctgaccgcaacgtcaggcgataccggcgcggcg
gtggctcacgcgttctatggcctggaaaatgtgcgggtcgtcattctctacccgcgcggt
aaaatcagtccgttgcaggaaaaactgttctgtacgctgggcggcaacattgaaaccgtg
gcgatcgacggcgatttcgacgcttgccaggcgctggtgaaacaggcatttgatgacgaa
gaactgaaaacggcgctggggctgaattcggctaattcgattaatatcagccgcctgttg
gcgcaaatttgctactactttgaagctgtggcgcaactgccgcagggggcgcgtaaccaa
ctggtgatctccgtccccagcggcaactttggcgatttgacggcagggctgctggcgaag
tcgttaggcctaccggtgaaacgttttatcgccgccaccaacgtcaacgacacggtgccg
cgttttctgcatgacggaaagtgggcgccgaaagcgacgcaggcgaccctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgcgtggaggagctattccgccgtaaaatc
tggcgcctgactgagctgggctatgcggcggtggatgacactacgacacaacagacgatg
cgcgagctgaaagcgaaaggttatatctcggaacctcatgcggcggtagcgtatcgggca
ttacgcgaccagttaaaccctggcgagtatggcttgtttctcggaacggcgcatccggcg
aagtttaaagaaagcgtggagtccattctgggagaaacgctggctttgcctgaagcgctc
gccgaacgcgccgatctgccgctgctttcacatcatctgcctgcggattttgccgccctg
cgtaagctgatgatgacccgccagtaa

DBGET integrated database retrieval system