KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0258Help
Entry
SeHA_C0258        CDS       T00738                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:2.7.4.-)
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SeHA_C0258 (dxr)
Enzymes [BR:seh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SeHA_C0258 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
265496..266779
Genome map
AA seq 427 aa AA seqDB search
MYKAPRRRHYQVSCAAFCFLFRFNTSGRFMKQLTILGSTGSIGCSTLDVVRHNPDSFRVI
ALVAGKNVARMAEQCLEFSPRYAVMDDTSSAEQLKIMLQQHGSRTEVLSGQQAACEMAAL
DEVGHVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDEVKRSNARLLPVDS
EHNAIFQSLPQSIQHNLGYADLEQNGVTSILLTGSGGPFRETPMCDLAAMTPDQACRHPN
WSMGRKISVDSATMMNKGLEYIEARWLFNASARQMEVLIHPQSVIHSMVRYQDGSVLAQL
GEPDMRTPIAHTMAWPNRVTSGAQPLDFCKLSALTFSAPDYQRYPCLKLAMEAFEQGQAA
TTALNAANEITVAAFLAQQIRFTDIAGLNLAVLERMDLQEPASVEDVLQVDAIAREVARK
QVIRLSR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaaagcgccgcgcagaagacattatcaggtctcctgtgcggcgttttgcttttta
ttccgtttcaacacttctggacgtttcatgaagcaattaaccattctgggctcgaccggc
tctattggttgcagcacactggacgtggtgcgccataatcctgatagcttccgcgttatc
gcgctggtggcgggtaaaaatgtcgcccgcatggcggagcagtgcctggagttctcgccg
cgttatgccgtgatggacgatacgtcgagcgcagaacagctcaaaataatgcttcagcag
catggcagccgcaccgaggttctgagcggtcagcaggctgcctgtgagatggcggcgctt
gatgaggtcgggcatgtgatggcggccattgtgggcgcggctggtttactgccgaccctg
gcggcgattcgcgcagggaagacgattctgctggcgaataaagaatcgctggtgacctgt
gggcggctgtttatggacgaagtaaaacgcagcaacgcccggcttttacccgtcgatagc
gaacataacgcgatttttcagagtttgccgcaatctattcagcataatctgggatacgct
gaccttgagcaaaatggcgtaacgtcgattttgcttaccgggtctggtggcccgtttcgt
gaaacgccaatgtgcgatctggcagcgatgacgccggatcaggcatgtcgtcatccgaac
tggtcgatggggcgaaaaatctccgtcgactccgccaccatgatgaataaaggtctggaa
tacattgaagcgcgttggttatttaatgccagcgcacgtcagatggaagtgttgatccat
ccgcaatcggtcattcattcgatggtgcgttatcaggacggcagcgtcctggcgcagctt
ggagaacctgacatgcgtacgcctattgcgcatacgatggcatggccgaatcgcgtcacg
tccggcgcgcagccgcttgatttttgcaaactcagcgcgctgacgtttagcgcgccagat
tatcagcgttatccatgcctgaagctggcgatggaggcgtttgagcaaggtcaggcggca
acgacggcgctcaatgcggcaaacgaaatcaccgttgccgcgtttctggcgcaacagatt
cgttttaccgatatcgccgggctcaatttagcggtgctggagaggatggatttacaggaa
ccggcaagcgttgaggacgtattgcaggttgacgccatcgcgcgtgaagtagcccgaaaa
caagtgatacggctctcacgctga

DBGET integrated database retrieval system