KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0860Help
Entry
SeHA_C0860        CDS       T00738                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00020  Citrate cycle (TCA cycle)
seh00310  Lysine degradation
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01120  Microbial metabolism in diverse environments
seh01130  Biosynthesis of antibiotics
seh01200  Carbon metabolism
Module
seh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
seh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeHA_C0860 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SeHA_C0860 (sucB)
Enzymes [BR:seh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SeHA_C0860 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: ACF68309
Position
852970..854178
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAVEPAAQPALGARGEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYVKAVV
EALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcgaccgtc
gccacctggcataaaaaaccgggtgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcggtt
ctggaagaggaggggaccactgtcacctctcgccagatcctgggtcgcctgcgtgaaggc
aacagcgcgggtaaagagaccagcgcgaaatctgaagagaaagcgtctacgccggcacag
cgccagcaggcgtcgctggaagaacaaaacaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacaatctggaagccagcgccattaaaggcactggtgtgggtgggcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaaggcgagtctaaagcacccgctgtt
gaacctgcagcgcaacccgctctgggcgcgcgcggcgaaaaacgcgtgccaatgacccgc
ctgcgcaagcgcgtggccgagcgtctactggaagcgaaaaattccaccgccatgctgacg
accttcaatgaagtcaacatgaagccgattatggatttgcgtaagcagtatggcgaagtg
tttgaaaaacgtcatggtatccgcctgggctttatgtccttctacgtgaaagcggtagtg
gaagcgctgaagcgttatccggaagtgaacgcctctatcgacggcgatgacgtggtgtat
cacaactactttgatgtgagcatggcggtgtctacgccgcgcggcctggtcacgccggtc
ctgcgtgacgtggatacgctgggcatggctgacatcgagaaaaaaattaaagaactggct
gtcaaaggccgcgacggcaagctgaccgtagaagacctgaccggtggtaactttaccatt
accaacggcggcgtattcggttcgctgatgtctaccccgatcatcaacccgccgcagagc
gcgattctgggaatgcatgctattaaagacaggccgatggcggtggatggcaaggtggaa
atcctgccgatgatgtacctggcgctctcttacgatcatcgcctgatcgatggtcgcgaa
tccgtgggcttcttggtcaccatcaaagagttgctggaagatccgacccgtctgctgttg
gacgtgtag

DBGET integrated database retrieval system