KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0900Help
Entry
SeHA_C0900        CDS       T00738                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.-)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:seh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:seh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(885607..886647)
Genome map
AA seq 346 aa AA seqDB search
MLNETPALAPDGQPYRLLTLRNSAGMVVTLMDWGATLLSARIPLSDGSVREALLGCASPE
HYPEQTSFLGASIGRYANRIANSRYTFAGETVQLSPSQGENQLHGGPEGFDKRRWQIVNQ
NDRQVLFALTSDNGDQGFPGHLCATAQYRLTDDNRISITYRATVDKPCPVNLTNHVYFNL
DGDRTDVRQHKLQILADEYLPVDESGIPRQGLKSVANTSFDFRMPKVIASEFLADDDQRK
VKGYDHAFLLQTQGDGKKPAARLWSQDGKLQMMVYTTAPALQFYSGNYLAGTPSRGPEPY
ADWQGLALESELLPDSPNHPEWPQPDCILRPGEEYASLTEYQFIPF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaatgaaacgcccgcactggcccccgatggtcaaccgtaccgcctgctaaccctg
cgcaatagcgcagggatggtggtaacgctgatggactggggagccactcttctttccgcc
cgtattccgctgtctgacggcagcgttcgggaagcattgctgggctgcgccagcccggaa
cactaccctgaacagacgtcattcctcggcgcctctattggccgttacgcgaaccgtatc
gccaatagccgttatacgtttgccggcgaaaccgtacagttaagcccaagccagggcgag
aaccagctacacggcggaccggaaggctttgacaagcgccgctggcaaattgtgaaccag
aacgatcgccaggtattattcgcgctcacctctgataacggcgaccagggctttcctggc
catctttgcgccacggcgcaatatcgtctgaccgatgacaatagaatctccatcacttac
cgggcaacggtcgataagccctgtccggtgaatttgaccaaccacgtctattttaatctg
gacggcgatcggaccgacgtgcgccagcataagctgcaaattctggcggatgagtatctg
ccggtagatgaatccggtattccacgccaggggctaaaatcggtagccaatacctcgttt
gacttccggatgccaaaagtcattgccagtgaatttctcgccgatgacgatcagcgcaag
gttaaaggctacgatcatgctttcctgctacagacgcagggtgatggcaaaaagccggcg
gcccgtctgtggtcacaggatggaaagctacaaatgatggtttacaccaccgccccggcg
ctacagttttattccggcaattatctggcgggtacaccttcccgcggaccagaaccttat
gccgactggcaagggctggcgctggaaagcgaactgctgccggacagtccgaatcatcct
gaatggccgcagcctgactgtatccttcgccctggcgaggagtacgccagcctgaccgag
tatcagtttattccgttctaa

DBGET integrated database retrieval system