KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1420Help
Entry
SeHA_C1420        CDS       T00738                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:seh00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1376160..1376816)
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVAEGDSTIDIANALIDWCQPRQIPVLASQDWHPAQHGS
FASQHQAEPYSQGELDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDACIYKGENPLIDSY
SAFFDNEHRQKTTLDTWLREHDVTELIVMGLATDYCVKFTVLDALELGYAVNVITDGCRG
VNIHPQDSAHAFMEMAAAGATLYTLADWEETQGQAVAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgggccttattactggtcgacttgcaaaatgacttttgcgccggcggcgcg
ctggctgtagcggaaggcgacagcaccatcgacatcgccaacgctcttattgactggtgc
cagccccggcagattccggtgctggccagtcaggactggcatcccgcgcagcatggcagc
ttcgccagccagcatcaggcggaaccctatagtcagggagagctggacgggctgccgcaa
acgctctggccggatcactgcgttcaacataccgacggcgcggcgttacatcccctgctt
aaccaacatgcgattgacgcctgcatctataagggtgaaaacccgctgattgatagctac
agcgcgttttttgacaacgaacatcggcagaaaactacccttgatacctggcttcgcgag
catgacgttaccgagcttatcgtgatggggttggcgaccgattactgcgtaaaatttacg
gtgctggatgcgctagagttgggctatgccgttaacgttatcaccgatggctgtcgcggc
gtgaatattcacccgcaggatagcgcacacgcgtttatggagatggcggcggcaggcgcg
acgctgtatacgctggcagactgggaagagacgcagggccaagctgtcgccaggtag

DBGET integrated database retrieval system