KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1455Help
Entry
SeHA_C1455        CDS       T00738                                 

Gene name
pfkB
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00010  Glycolysis / Gluconeogenesis
seh00030  Pentose phosphate pathway
seh00051  Fructose and mannose metabolism
seh00052  Galactose metabolism
seh00680  Methane metabolism
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01120  Microbial metabolism in diverse environments
seh01130  Biosynthesis of antibiotics
seh01200  Carbon metabolism
seh01230  Biosynthesis of amino acids
Module
seh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seh_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeHA_C1455 (pfkB)
   00030 Pentose phosphate pathway
    SeHA_C1455 (pfkB)
   00051 Fructose and mannose metabolism
    SeHA_C1455 (pfkB)
   00052 Galactose metabolism
    SeHA_C1455 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SeHA_C1455 (pfkB)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SeHA_C1455 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ACF68698
Position
complement(1410134..1411066)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLEDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGEALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgccattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgatgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggaagatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgaggcgctcaccgccgcgctggcgcttggcgat
atcgaactggtaaaacctaacctgaaagaattgagcgcgttggtcaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaagctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtaggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttcccgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system