KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1455Help
Entry
SeHA_C1455        CDS       T00738                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeHA_C1455 (pfkB)
   01230 Biosynthesis of amino acids
    SeHA_C1455 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeHA_C1455 (pfkB)
   00030 Pentose phosphate pathway
    SeHA_C1455 (pfkB)
   00051 Fructose and mannose metabolism
    SeHA_C1455 (pfkB)
   00052 Galactose metabolism
    SeHA_C1455 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SeHA_C1455 (pfkB)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SeHA_C1455 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1410134..1411066)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLEDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGEALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgccattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgatgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggaagatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgaggcgctcaccgccgcgctggcgcttggcgat
atcgaactggtaaaacctaacctgaaagaattgagcgcgttggtcaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaagctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtaggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttcccgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system