KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1915Help
Entry
SeHA_C1915        CDS       T00738                                 

Definition
(GenBank) tryptophan biosynthesis protein trpCF (EC:4.1.1.48 5.3.1.24)
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SeHA_C1915
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SeHA_C1915
Enzymes [BR:seh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SeHA_C1915
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SeHA_C1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1869522..1870880
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIASIYQHYASAISVLTDEKYFQGSFDFLPIVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLKMGVLTEVSNDEERERAIALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKVCGLTRAQDAKAACDAGAIYGGLIFVPSSPRAVSVEQAREVI
SGAPLQYVGVFQNADIADVCQKAAVLSLSAVQLHGSEDQAYVNALREALPRNVQIWKALS
VSDALPARDYHHVDKYIFDNGQGGSGQRFDWSLLRGQPLDDVLLAGGLAADNCVQAAQVG
CAGLDFNSGVESQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagttttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgatgatttcgatccggcgcgtattgccagtatttatcaacattac
gcctcggcgatctcggtgctcaccgacgaaaaatattttcaggggagcttcgattttctg
ccgatcgttagccaaagcgcgccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcggtt
ctggatgacgaacagtatcgccagctctccgccgtcgcgcacagtctgaaaatgggcgtg
ctcacggaggtcagtaatgacgaagaacgggagcgcgcgatagcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgactgtcatcagcgagtccgggattaacacctat
ggtcaggtacgcgaactgagccacttcgccaacggttttttaattggctccgcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgcttggcgaaaataaagtctgc
ggtctgacccgcgcccaggacgccaaagctgcctgtgacgctggcgcaatatatggcggg
ttgatttttgtgccctcatctccgcgcgcggttagcgttgagcaggcgcgagaagtgata
agcggcgcgccattgcagtatgtcggcgttttccagaacgctgatatcgccgatgtttgc
cagaaagccgccgtcctgtcgctttctgccgtacagctacatggcagcgaagaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgcgcaatgtgcaaatctggaaggcgctgagc
gttagcgatgcccttcccgcacgcgattatcaccatgtcgataaatacattttcgacaat
gggcaaggcggcagcgggcagcgcttcgactggtcactgctacgggggcaaccgctggat
gatgtgttactggcgggcgggctggcggccgataactgcgtccaggcggcgcaagtcggc
tgtgccggtctcgattttaattcaggtgtggagtcacagccgggcatcaaagatgctcgt
cttctggcctcggtttttcagacactgcgcgcatattaa

DBGET integrated database retrieval system