KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C1917Help
Entry
SeHA_C1917        CDS       T00738                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00260  Glycine, serine and threonine metabolism
seh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01130  Biosynthesis of antibiotics
seh01230  Biosynthesis of amino acids
Module
seh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SeHA_C1917 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SeHA_C1917 (trpA)
Enzymes [BR:seh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SeHA_C1917 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth NMO NanE
Motif
Other DBs
NCBI-ProteinID: ACF69359
UniProt: B4TJK9
Structure
PDB: 

Jmol
Position
1872083..1872889
Genome map
AA seq 268 aa AA seqDB search
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRS
GVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKI
IEKNLASPEQMLAELRSFVSAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaaaatttatttgcacagctcaacgatcgccgggaaggcgcttttgtc
cccttcgtgactctgggcgaccctggcattgaacagtcactgaaaattatcgacacactg
attgacgctggcgccgacgctctggagctgggggttcccttctccgatccgctggccgat
ggccctaccatccagaatgcgaacttacgcgccttcgccgctggcgtcacgccggctcag
tgttttgaaatgctggcgctgattcgtgaaaaacacccgaccattccgattggcctgcta
atgtacgcgaatctggtattcaataacggcatagatgcgttctatgcccgttgtgaacag
gttggcgtagattccgtgctggtcgcagatgtcccggttgaagagtcggcccccttccgc
caggcggcgttacggcataatatcgcgccgatcttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcatcttacggccgcggttacacctacctgctttcgcgttcg
ggcgtcaccggcgcggaaaaccgtggcgcattgccgttgcatcatctcattgagaagctt
aaagagtaccacgccgcgcctgcgttacagggcttcggtatctcctcgccggaacaggtg
tctgcggccgtgcgtgccggggcggctggcgctatctccggctcagccattgtcaagatt
atcgagaaaaacctcgcgtctcccgaacagatgttggcggagctcaggtcctttgtctca
gcgatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system