KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C2324Help
Entry
SeHA_C2324        CDS       T00738                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SeHA_C2324 (galF)
   00052 Galactose metabolism
    SeHA_C2324 (galF)
   00500 Starch and sucrose metabolism
    SeHA_C2324 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SeHA_C2324 (galF)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SeHA_C2324 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2226576..2227469)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtactggtgactcacgcgtctaaa
aacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttcttgaacagcgc
gttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtaacgattatg
aacgttcgccaggcgcagccgttagggctggggcactctattctgtgcgcgcgtccggtc
gtaggcgataaccctttcattgtggtactcccggatattattatcgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagccgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgtatccagctcaccgat
gccattgcagaactggcgaaaaaacagtcggttgacgcgatgctaatgacgggtgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagcgaagttccgtaagagcatagagcagcttttgcatgaataa

DBGET integrated database retrieval system