KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C2742Help
Entry
SeHA_C2742        CDS       T00738                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:seh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:seh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2654217..2655344
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQVANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgcaggctgtcaggcattaatgattgaacgccttcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgagcctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcgcagcatcctcat
caccggggccgcctcgcatttttgattacctctgatgaggaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttct
ctcacctgtaacctcactatccatggcgttcaggggcacgtcgcctatccgcatctggcg
gataaccctgttcatcgcgccgcgccttttcttaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcaggtagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggcgaactgttcgtgcagtttaacttccgtttcagcacg
gaactgaccgatgagatgatcaaagagcgggtacatgcgctgcttgaaaagcatcagcta
cgctataccgtagactggtggctttccggccagccgttcctgaccgcacgcggcaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaatgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgcattatggaacagctcgtcgcctga

DBGET integrated database retrieval system