KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C3274Help
Entry
SeHA_C3274        CDS       T00738                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Brite
Enzymes [BR:seh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SeHA_C3274
Secretion system [BR:seh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SeHA_C3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3194877..3195590)
Genome map
AA seq 237 aa AA seqDB search
MKKRFMMFTLLAAAFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYV
TDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVK
PASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcgttttatgatgttcactttactggcggcggcgttttcaggcgtggcccat
gcggatgatgcggctatccgtcagtcgctggctaagctgggcgttcagagtacggaaatt
caggcctcgccagtggcagggatgaaaaccgtcctcactcacagcggcgtactgtacgtc
actgatgacggcaaacatattattcaagggccgatgtatgacgtgagcggcgcgcatccg
gtaaacgtgacgaacaaactgctgatgagccagctaaatgcgctggaaaaagagatgatc
gtctataaagcgccggatgagaaacatgtcattactgtttttaccgatatcacctgcggc
tattgtcataagctacatgaagagatgaaagattataacgcgctggggatcacggttcgt
tatctggccttcccgcgccaggggctggaaagccaggcggagcaggatatgaaatctatc
tggtgcgccaaagacaaaaacaaagcgtttgatgacgccatggcaggtaagggcgtgaaa
ccggcaagctgtgacgtgaacattgctgatcattatgcgttgggcgtgcagttgggcgtt
agcggtacgccagccattgtattgagtaacggctatgtggtgcctggctatcagggaccg
aaagagatgaaagcgtttcttgatgagcatcaaaaacagaccagtggtaaataa

DBGET integrated database retrieval system