KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4106Help
Entry
SeHA_C4106        CDS       T00738                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeHA_C4106
Enzymes [BR:seh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SeHA_C4106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3990152..3991534
Genome map
AA seq 460 aa AA seqDB search
MRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPGRFHQGVGPAETSTFYRH
WKQDIALLKQLKHNSFRTSLSWARLIPDGVGEVNPQAVSFYNHVIDELLAQGITPFITLF
HFDMPMVMQEKGGWENRDVVEAFGRYAQTCFTLFGDRVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFKRAATVAYHTVLAHSTAVRAWRAGRYDGEIGIVLNLTPSYPRSQHPADVQAAH
HADLLFNRSFLDPVLKGEYPADLVALLKTYDQLPACQPGDRQLIADGKIDLLGINYYQPR
RVKCRDTAVNPQAPFMPEWLFDYYDMPGRKMNPYRGWEIYAPGIYDIITNLRDNYGNPRC
FISENGMGVENEQRFVQAGQIHDDYRIDFISEHLKWLHKGISEGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQTRTVKKSGEWFAATAEHNGFD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccgttttcccgataacttctggtggggcagcgcctgctcagcgttgcaaacc
gaaggggatagtctgaatggcggtaaaagccagaccacgtgggatgtgtggttcgagcgc
cagccgggtcgttttcaccagggcgtcggtccagcggaaacctcaacgttctatcgccac
tggaagcaagacatcgcgctactgaaacagttaaaacataacagttttcgcacctcgcta
agctgggcgcggctcattccagacggcgtaggcgaggtgaatccacaagcggtgagcttc
tacaatcacgtcatcgacgagctactggcgcagggcatcacgccgtttattacgctgttc
cattttgatatgccgatggtcatgcaggagaaaggcggctgggaaaatcgcgacgtcgta
gaggcgtttggtcggtacgcgcaaacgtgttttaccttgtttggcgaccgcgtgaagcac
tggtttacctttaacgagccgattgtgccggtggaaggcggctatttgtacgacttccac
tatcccaatgtggtggattttaaacgggcggccaccgtggcgtaccataccgtgctggcg
cactcgaccgccgtgcgcgcctggcgcgccgggcgctacgacggtgaaatcggcatagta
ctgaatctgacgccgtcctacccacgctcgcagcatcccgccgatgtgcaagccgcgcac
catgcggatctgttattcaaccgcagttttcttgacccggtattaaagggagaatacccg
gcggacttggtggcgctgctgaaaacctatgaccagttgcctgcctgtcagccaggcgac
cgtcagcttattgccgacggcaaaatcgatttactggggattaactattatcagccgcgc
cgcgtgaaatgccgtgatacggcggtgaatccgcaagcgccgtttatgccggagtggtta
tttgactattacgacatgccggggcgcaagatgaacccttaccgcggctgggaaatttac
gcgccaggaatttacgacatcatcaccaacctgcgggataattacggcaatccgcgctgt
tttatctccgaaaacgggatgggcgttgagaacgagcagcgttttgtgcaagcgggacag
attcacgatgattaccggattgactttatttctgagcatcttaaatggctgcataaaggc
attagcgagggctgtcactgtcttggctaccacatgtggacctttatcgataactggtca
tggctgaacggctataaaaatcgctatggttttgtacaactggatttagccacccaaacg
cgcacggtgaaaaaaagcggagaatggtttgccgccaccgcagagcataacggttttgat
taa

DBGET integrated database retrieval system