KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4152Help
Entry
SeHA_C4152        CDS       T00738                                 

Definition
cytoChrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Brite
Enzymes [BR:seh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SeHA_C4152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4032803..4034203)
Genome map
AA seq 466 aa AA seqDB search
MKKITLYATTVITVGLLCYLGLSGYVWYYDKQRSKKSDVQASVVGENNKILGYFREKGCD
YCHTPSAELPFYSSFPVAKQLMDYDIQLGYKSFNLEAVRAALIADTPVPQSELNKIEWVM
QHQTMPPTRYVALHWAGGVSDKERTDILNWIADQRERNYASADTDPAHRNEPVQPIPRNI
PVDAKKVDLGFRLYHDERLSGDSTISCAHCHAINAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNIEQFWDGRAATLQEQAGGPPLNPIEMASKSWDEIISKLDKDPVLKKDFQAVYPQG
FTGENITDAIAEFEKTLITPDSAFDKWLRGDENALTAQQKHGYQLFKENKCATCHGGIIL
GGRSFEPLGLKRDFNFGEITAADIGRMNVTKEVRDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGTDLPQNDIDDIVAFLESLTGVYTPYQPEYAQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattaccctctatgcgacaacggttatcaccgttgggctgttatgttattta
ggtttgtccgggtatgtatggtattacgacaaacagcgcagtaaaaaaagcgatgtgcag
gcctcggttgtgggtgaaaataataaaatactgggttatttcagggagaaaggatgtgat
tattgtcatacgccttccgctgaattacctttttattcctcttttccggtggcaaagcag
ctaatggattacgatatccagcttggctacaaatcgtttaacctggaggcggtacgggcc
gccctgattgcggatacgccggtgccgcaaagcgaactgaataaaattgaatgggttatg
caacatcagactatgccgccaacccgctatgtcgcgctgcactgggcggggggcgtcagc
gataaagagcgtactgacatcctgaactggatagccgatcagcgtgagcgcaactatgcc
agcgccgataccgacccggcgcaccggaatgaacccgttcagcctattccgcgcaatatt
cccgtcgatgcgaaaaaagtcgacttaggtttccgtctttatcatgatgaacgtttatcc
ggcgacagcacaatatcctgtgcgcattgtcacgcgataaatgcgggcggtgtcgatggc
agaaaaacctcaattggcgttggcggcgcggtagggccgataaatgcgccaacggtattc
aactccgtatttaatatcgaacaattttgggatggccgtgctgcaaccctgcaggagcaa
gcaggcggaccgccgttaaatcctattgaaatggcttctaaatcctgggatgaaattatt
agcaagcttgataaagatcctgtcctgaaaaaagatttccaggcggtttatccgcaagga
tttaccggggaaaatattactgatgcgatcgccgaattcgaaaaaacgttgataacgccg
gattccgcctttgataaatggctacgtggagatgaaaatgcgctgaccgcgcaacagaaa
cacggttatcaattatttaaagagaataaatgtgcaacctgtcacggcggtatcatttta
ggcggacgctcttttgaaccattgggattaaagcgagactttaattttggcgaaattacc
gcagcggatattggtcgtatgaacgtcaccaaagaggttcgcgataaattacggcaaaaa
gtcccaggcttacgcaacgtcgcgttaacagcgccttatttccatcggggcgacgtaccg
acgctggatggcgcggtaaaactgatgctgcgttaccaggttggcaccgatctgccgcaa
aacgatattgacgatatcgtcgccttcctggaaagcctgaccggtgtttatacgccatat
caacctgaatatgcgcaatga

DBGET integrated database retrieval system