KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4309Help
Entry
SeHA_C4309        CDS       T00738                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit FadB (EC:4.2.1.17 5.3.3.8 1.1.1.35 5.1.2.3)
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeHA_C4309 (fadB)
   01212 Fatty acid metabolism
    SeHA_C4309 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SeHA_C4309 (fadB)
   00650 Butanoate metabolism
    SeHA_C4309 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SeHA_C4309 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SeHA_C4309 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SeHA_C4309 (fadB)
   00310 Lysine degradation
    SeHA_C4309 (fadB)
   00380 Tryptophan metabolism
    SeHA_C4309 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SeHA_C4309 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SeHA_C4309 (fadB)
   00281 Geraniol degradation
    SeHA_C4309 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SeHA_C4309 (fadB)
   00930 Caprolactam degradation
    SeHA_C4309 (fadB)
Enzymes [BR:seh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SeHA_C4309 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SeHA_C4309 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SeHA_C4309 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     SeHA_C4309 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(4197686..4200001)
Genome map
AA seq 771 aa AA seqDB search
MISAERDHIGISLIIYLHFINTKYTLRFIWYDQITLWIQETDMLYKGDTLYLDWLEDGIA
ELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAI
AVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAV
LGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLASVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPETVLASNTSTIPIGELAS
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKEYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVSQP
KRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQ
GSAKYLDMAQQYQHLGPLYEVPEGLRDKARHNEPYYPPVEPARPVGSLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctgccgagcgtgatcacatcggcatttctttaatcatttatttgcattttatt
aacacaaaatacacacttcgcttcatctggtacgaccagatcaccttgtggattcaggag
actgacatgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgcc
gaactggtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagc
ctcggccaggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgc
tctaataaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctc
gtccccgaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctg
gaagatttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgc
gaatgcgtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccg
gaaactaaactgggtatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctg
ggcgcagacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcg
ctgaaaatcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgata
gcggtgttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaa
ctggaaccgttgaaactcagtaagattgaagcagcgatgagctttaccatcgctaaaggc
atggtcgcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccatt
gaagccgccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgtt
ccgctggcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatat
gtaaaaggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgta
ctgggcgcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccg
gtcatcatgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaag
ctgctgaacaaacagctggagcgcggcaagatcgacggtctgaagctggcgagcgtcatt
tcgaccatccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaa
gcggtagtcgaaaatccgaaagtgaaaaaagcggtactggcggaaaccgagcagaaagtg
cgcccggaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagc
gccctggaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatg
ccgctggttgaaatcattcgcggcgagaagagttcagacgaaaccatcgccaaagtcgtc
gcctgggcaagcaaaatgggcaagacgccgattgtagtcaacgactgccccggcttcttt
gttaaccgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcg
gatttccgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcc
tatctgctcgacgtggtgggtattgataccgcccaccacgcgcaggcggtaatggcggca
ggcttcccgcaacggatgcagaaagagtatcgcgacgcgatcgacgcattgtttgacgcc
agccgttttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggt
aagccgaagaaagaagaagatgccgcggtggatgacctgctggcaagcgtcagccagccg
aaacgcgacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaa
gtggttcgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacag
ggcagcgcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgaa
gtgccggaagggctgcgtgataaagcgcgccataacgaaccgtattatcccccggttgaa
ccagcccgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system