KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4393Help
Entry
SeHA_C4393        CDS       T00738                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeHA_C4393 (pfkA)
   01230 Biosynthesis of amino acids
    SeHA_C4393 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeHA_C4393 (pfkA)
   00030 Pentose phosphate pathway
    SeHA_C4393 (pfkA)
   00051 Fructose and mannose metabolism
    SeHA_C4393 (pfkA)
   00052 Galactose metabolism
    SeHA_C4393 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SeHA_C4393 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SeHA_C4393 (pfkA)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SeHA_C4393 (pfkA)
Protein phosphatases and associated proteins [BR:seh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SeHA_C4393 (pfkA)
Messenger RNA biogenesis [BR:seh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SeHA_C4393 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4276710..4277672
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDIKGTDYTIGYFTALGTVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVVPEVEFNREDLVAEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLEGHGGRCVGIQNEQLVHHDIIDA
IENMKRPFKSDWMECAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccgggcatgaacgcggca
atccgcggtgttgtgcgcgcagcgttgacggaagggctggaagtcatgggcatttatgac
ggctatctgggcctgtatgaagatcgtatggttcagcttgaccgttacagcgtatctgac
atgatcaaccgtggcggtactttcctcggttctgcccgtttcccggaattccgtgacgaa
aatattcgcgctgtcgcgatcgaaaacctgaaaaaacgcggtatcgatgcgctggtagtt
attggcggcgacggttcttatatgggtgcaaaacgtctgactgaaatgggcttcccgtgc
atcggtctgccaggcactatcgataacgacatcaaaggcaccgactacactatcggctat
ttcactgctctcggcactgtagtggaagcgattgaccgtctgcgtgacacctcctcttct
caccagcgtatctctatcgttgaggtgatgggccgttattgcggcgacctgacgttggcg
gcggctattgctggcggctgtgagtttatcgtggtgccggaagttgaatttaatcgcgaa
gatctggtggccgaaatcaaagccgggatcgcgaaagggaaaaaacacgctatcgtcgct
attactgagcatatgtgcgatgttgacgaactggcgcactttattgaaaaagaaacgggc
cgtgagacgcgtgcgacggtgctcggccacattcagcgcggtggttccccggtaccttac
gatcgcattctggcttcccgtatgggcgcgtatgctattgacctgctgctggaaggccat
ggcggtcgttgtgtcggtatccagaacgagcagcttgttcatcatgacatcatcgatgcg
attgaaaacatgaagcgtccgttcaaaagcgactggatggagtgcgcgaaaaaactgtac
tga

DBGET integrated database retrieval system