KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4412Help
Entry
SeHA_C4412        CDS       T00738                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeHA_C4412 (tpiA)
   01230 Biosynthesis of amino acids
    SeHA_C4412 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeHA_C4412 (tpiA)
   00051 Fructose and mannose metabolism
    SeHA_C4412 (tpiA)
   00562 Inositol phosphate metabolism
    SeHA_C4412 (tpiA)
Enzymes [BR:seh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SeHA_C4412 (tpiA)
Exosome [BR:seh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SeHA_C4412 (tpiA)
  Exosomal proteins of bladder cancer cells
   SeHA_C4412 (tpiA)
  Exosomal proteins of melanoma cells
   SeHA_C4412 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4294647..4295414)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactgacgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaggatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgagctgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtatgcgcacgccagatcgacgcggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttacgaacccgtatgggcgatcggtaccggtaaatctgcaacgcct
gcgcaggcgcaggcagtgcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggttattatccagtacggcggttctgttaatgcctccaacgccgccgaa
ctgttcgcgcagccggacatcgacggcgcactggtaggcggcgcttctctgaaagctgac
gccttcgcggtgatcgtgaaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system