KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4517Help
Entry
SeHA_C4517        CDS       T00738                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00630  Glyoxylate and dicarboxylate metabolism
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01120  Microbial metabolism in diverse environments
seh01200  Carbon metabolism
Module
seh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SeHA_C4517 (aceA)
Enzymes [BR:seh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SeHA_C4517 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACF67185
Position
4399056..4400360
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDSGFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtactcaacaaatcgaagaattacagaaagagtggacacaaccgcgctgg
gaaggcatcacccgcccgtacagcgcggaggaggtggtgaaattacgcggctcggttaac
ccggaatgcacgctggcgcagctcggcgccgcgaaaatgtggcggctgttgcacggtgaa
gcgaaaaaaggctatatcaacagccttggcgcgctgaccggcggtcaggcgttgcagcag
gcgaaagctggtattgaggcgatttatctttcaggctggcaggtggcggcagatgccaac
ctggcatccagcatgtatccggatcaatcgttgtacccggcaaactctgttccggcggta
gtggatcggatcaacaacacttttcgtcgtgcagatcagatccagtgggcatccggtatt
gaacccaacgatccgcgctatgtggattacttcctgccgatcgttgctgatgcggaagct
ggttttggcggcgttctgaatgccttcgaactgatgaaatcgatgattgaagccggtgca
gcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgcggccatatgggcggc
aaggtgctggtccccacgcaggaggcgattcagaaactggttgctgcgcgtctggccgct
gatgtgatgggcgtcccgacgctggtgattgcgcgtaccgatgcggatgcggcagatctg
atcacctccgactgcgatccctatgacagcggttttattaccggcgaacgcaccagcgaa
ggtttttaccgcacccatgcgggcattgagcaggcgatcagccgcggtctggcgtatgcc
ccgtatgccgatctggtatggtgcgaaacttctacgccggatctcgaactggcgcgtcgt
tttgccgatgctatccacgcgaagtatccgggcaaactgctggcctataactgttcgcca
tccttcaactggcagaagaatctggacgacaagaccattgccagcttccagcagcagttg
tcggacatgggttacaaataccagtttattaccctggcgggcatccacagcatgtggttc
aacatgttcgacctggcgcatgcatacgctcagggtgagggtatgaaacactatgttgag
aaggttcaacaacccgagttcgccgcggcgaaagacggctacacctttgtttcccaccag
caggaagtgggcactggttacttcgacaaagtcaccaccattattcagggcggcgcgtca
tccgttaccgcgttaacgggttccaccgaagaatcgcagttttga

DBGET integrated database retrieval system