KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4965Help
Entry
SeHA_C4965        CDS       T00738                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00230  Purine metabolism
seh00240  Pyrimidine metabolism
seh01100  Metabolic pathways
seh03030  DNA replication
seh03430  Mismatch repair
seh03440  Homologous recombination
Module
seh_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SeHA_C4965 (holD)
   00240 Pyrimidine metabolism
    SeHA_C4965 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SeHA_C4965 (holD)
   03430 Mismatch repair
    SeHA_C4965 (holD)
   03440 Homologous recombination
    SeHA_C4965 (holD)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SeHA_C4965 (holD)
DNA replication proteins [BR:seh03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SeHA_C4965 (holD)
DNA repair and recombination proteins [BR:seh03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SeHA_C4965 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: ACF67049
Position
4843615..4844052
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLAPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttacccctggcgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system