KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4965Help
Entry
SeHA_C4965        CDS       T00738                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SeHA_C4965 (holD)
   00240 Pyrimidine metabolism
    SeHA_C4965 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SeHA_C4965 (holD)
   03430 Mismatch repair
    SeHA_C4965 (holD)
   03440 Homologous recombination
    SeHA_C4965 (holD)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SeHA_C4965 (holD)
DNA replication proteins [BR:seh03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SeHA_C4965 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4843615..4844052
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLAPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttacccctggcgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system