KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00006Help
Entry
A35E_00006        CDS       T02336                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A35E_00006
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A35E_00006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11209..11712)
Genome map
AA seq 167 aa AA seqDB search
MRKCVIENVWLAIGSNLGDPTKQVKAALMAIGSLPNTRLLVCSSYYRSLPLGPQDQPDFL
NAVLLLETSLTPDKFLDYIQAIERCQGRKKHVYRFGPRTLDLDILLFGKRIITTPRLIVP
HYDMYNREFVLYPLLEVAPNLIFPDGTLLIQRLSRISRKNLTYWVKE
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaagtgtgtcatagaaaatgtttggttagcgattggaagtaacctgggagatccg
acaaaacaagtaaaagctgctcttatggcgataggaagtttacctaatactcggttattg
gtttgctcgtcttattatcgcagtcttcctttgggtccgcaggaccaaccagatttttta
aatgctgttttattattagaaacaagtttaacacctgacaagtttcttgattatatccaa
gctattgaacgatgtcagggtcgcaagaaacatgtttatcgttttggacctcgcacattg
gatctggatattttattatttggaaaacgaattattactactcctcgattaatcgttccg
cattacgatatgtataatcgtgaatttgtcctgtatcctttgttagaagttgctccgaac
ttgatatttcctgatggaaccttattaatacaacgtttaagtcggatatcgcgtaaaaat
ctcacctattgggttaaagagtaa

DBGET integrated database retrieval system