KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00058Help
Entry
A35E_00058        CDS       T02336                                 

Definition
DNA helicase/exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A35E_00058
Enzymes [BR:sehc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A35E_00058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(114621..116489)
Genome map
AA seq 622 aa AA seqDB search
MKSILSEAQQLSCFRSIDVQFGLMVATRSDDNQGLMLLASVWVSANTAMGHVCLPLKDLN
RKNLFSGRMPELARRAWIHAGNPSLKDWKKCLLASQAVSDGSRPTPLVLEHDNLYLQRMW
EYECIVANFFNQPRIIPIKLDEVRIADVLRRYFPGDTHVVNWQKVATAIAITNFVVLISG
GPGTGKTSTVAKVLASLLQISNQQQQYLRIVMAAPTGKAAIRLSQSLGLALQHLELNEEQ
KKQLPREAVTLHRLLGLETDSQRMRYHSNNLLNLDILIIDEASMIDLPMMAHLVSAVPAK
ARVIFFGDHCQLSSVESGAVFKDICQFIKSGYSLNRREQLKRLTGFTLPGEKVRDVFRVS
DSLCLLRKSYRFNKNSGIAKLANAINSGNGKTALKLLKSSTVKDIDYISLYNLKDYQSMI
DNCIQGYQDYLRCLHNNDEPRVILESFNRFRLLCALRNGIFGVEGLNCSIEQALNRIGLI
TLDNGNSSYLGRPIMIMENEVSMGLYNGDIGLVLSKNIYSLCVYFPLSDGGVKEVPISLL
PKHETAFSMTVHKSQGSEFERVVLVLPNKTSSLLTRELFYTAVTRVRKRFSLYARDDIVR
HIISNRIQRNSGLVQRLSIKLV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctattctttcagaggcgcaacaattatcttgttttcgatctatagatgttcaa
tttggtttaatggtagcaacaagatctgatgataatcagggattgatgctactagctagt
gtgtgggtaagtgctaataccgctatgggtcatgtttgtttacccttgaaagatttgaat
cgaaaaaatctattttctggtcgaatgccagaattggcacgacgagcatggatacatgct
ggcaacccttctctaaaagattggaagaaatgtcttctagcgtcacaagctgttagtgac
ggttctcgacctaccccgcttgtcttagagcatgataatctatatttacaacgcatgtgg
gaatatgaatgcatagtagcaaatttttttaatcaaccaaggataatacccataaagctt
gatgaagttagaattgctgatgttttaagacgttatttccctggtgatacacatgtagtt
aattggcaaaaagttgctacagcgattgcaataacaaatttcgtagttcttatatccgga
gggcctgggactggaaaaacctctacggttgcaaaggtacttgcatcactattgcaaatt
agtaatcaacaacagcagtatttgcgtattgtaatggcagcccctaccggtaaagcagct
atacggctaagtcaatcgttaggtttggcattacaacatttagaattaaatgaagaacaa
aaaaaacagttaccgcgtgaagcagtaacactacatcgtttgcttggattagagactgat
agtcaacgtatgcgttatcactctaataatttattgaatttagatattttaataattgat
gaagcttcaatgattgatttaccaatgatggctcatcttgtttcggctgttcctgcgaag
gctcgggtaattttttttggggatcattgtcaactgtcttctgtagaatcaggtgcagtt
tttaaagatatttgtcagttcataaaatcaggttatagccttaatcggcgagaacaatta
aagcgattaactggttttacattgccaggagagaaagttcgtgatgtttttagagtttct
gatagtctttgcttattaaggaaaagctaccgttttaataaaaattctggtatcgcaaag
ttagctaatgcaattaattccgggaacgggaaaacagcattaaaacttctaaaatcttca
acggtaaaagatatagattatatatcactttataatttaaaagactatcaaagcatgata
gataactgcattcaaggttaccaagactatttaaggtgcctacataataatgatgaaccg
agagtgattttagaatccttcaatcgttttcgtttactttgtgctctacgtaacggaatt
tttggagttgaagggcttaattgttctattgaacaggctttgaatcgcattggtttgatt
actcttgataacggtaattctagttatttaggtcggcctataatgattatggaaaatgag
gtttcgatggggttgtataatggggatattggtcttgttctatcaaaaaatatatattcg
ttatgtgtttattttcctctatcagatggaggtgtaaaagaagtgccgataagtctgtta
ccaaaacatgaaacggctttttcgatgacagttcataaatctcaggggtcagagtttgag
cgtgttgtattagtattacctaataaaacctcttctttacttacaagagagctattctac
actgcagtaacacgagtacgcaagcgattttctctctacgctagagatgatatcgttcga
catattatttctaatcggattcagagaaatagtggtttagttcaacgattatctattaaa
ttagtatag

DBGET integrated database retrieval system