KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00061Help
Entry
A35E_00061        CDS       T02336                                 

Definition
(GenBank) endonuclease III, DNA-(apurinic or apyrimidinic site) lyase
  KO
K10773  
endonuclease III [EC:4.2.99.18]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    A35E_00061
Enzymes [BR:sehc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     A35E_00061
DNA repair and recombination proteins [BR:sehc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A35E_00061
 Prokaryotic Type
     A35E_00061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
126546..127184
Genome map
AA seq 212 aa AA seqDB search
MNNDKRYEIILRMQDHTPHPTTELVYRSPFELLIAVILSAQATDISVNKATQILFSYANT
PQDIITLGIDNLKIYIKSIGLFNIKAKNIIKTCQILLEQYKSKVPQNRKKLETLPGVGRK
TANVVLNSAFGWPTIAVDRHVFRVSNRTRFARGKNVTLVEKKLLSVVPREFKKTFHHWFV
SHGRYTCTSKKPRCNVCIIRDLCEYDKKYYVK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatgacaaacgttatgaaatcatcttacgtatgcaggatcataccccccaccct
acgacggaattagtttatagatcgccgtttgaactgttgattgcagtaatactatccgct
caagcaactgacattagtgtaaataaagctacacaaatactattttcatatgctaatact
cctcaagatataataacgctaggtattgacaaccttaaaatctatataaaatctatagga
ttatttaacattaaagcgaaaaatataatcaaaacatgccaaattttattagaacaatat
aaaagcaaagttcctcaaaatagaaaaaaactagaaacactacccggagttggacgaaaa
actgcaaatgtagtgttaaatagtgcgtttggttggcctactattgcggttgataggcat
gtttttcgggtttcaaatcgtacccgttttgcaaggggaaaaaatgtaacattagtagag
aaaaaacttttaagtgtagttcctagagaatttaaaaaaacttttcatcattggtttgtt
agtcatggccgatatacttgtacatccaaaaaacctcgatgtaacgtttgcataattaga
gatttatgtgaatatgataaaaaatattatgtaaaataa

DBGET integrated database retrieval system