KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00063Help
Entry
A35E_00063        CDS       T02336                                 

Definition
(GenBank) thioredoxin
  KO
K03671  
thioredoxin 1
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Chaperones and folding catalysts [BR:sehc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   A35E_00063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
129508..129852
Genome map
AA seq 114 aa AA seqDB search
MEKTENMSDKIICVTDTNFKINVLQSKRMVLVDFWAEWCGPCKTILPILSEIANEFDGKL
TIAKLNVSENPDTTTKYHIQSIPTLLLFHNNKVLDSKCGSISKKQIKEFVNQYL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaacagaaaatatgagtgataaaattatttgtgtaactgatactaactttaaa
ataaacgtattgcagtctaaaagaatggtgcttgttgatttttgggcagaatggtgtggt
ccttgtaaaacaattttaccaatcttatctgaaattgctaatgaatttgacggaaaatta
actattgcgaaattaaatgtcagtgaaaatccagacactacaacaaaatatcatatacaa
agtattccaactttattactgttccataacaataaagtattagatagtaagtgcggttct
atatctaaaaaacagataaaagaatttgttaatcaatatttataa

DBGET integrated database retrieval system