KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00066Help
Entry
A35E_00066        CDS       T02336                                 

Definition
(GenBank) putative ATPase involved in cell division
  KO
K09812  
cell division transport system ATP-binding protein
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
ABC transporters
Module
Cell division transport system
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    A35E_00066
Chromosome [BR:sehc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    A35E_00066
Transporters [BR:sehc02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Cell division transporter [MD:M00256] [OT]
    A35E_00066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
132978..133646
Genome map
AA seq 222 aa AA seqDB search
MIRCKQVGKTYHTGHQALQEINFHVRENEKICLTGYSGSGKTTLLELICGIQRPTTGHIF
FNGYNLSSLKTNEILSLRRQIGIIFQDHHLLLERTVYDNVAIPLIVCGESLNIIRRRVPA
ALDRVGLLDKAKNTPIQLSRGEKQLIAIARAIINKPAVLVIDEPTNHLDDIVSNTIFCLF
EEFNHIGVAILMATINTRLIANRNYRVLTLHKGKVTENLHAK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattcggtgcaaacaagtaggaaaaacctatcatactggacaccaagcattacaagaa
ataaattttcatgtacgtgaaaatgaaaaaatctgtcttactggttattctggatctgga
aaaactactctgctagaattgatatgtggcattcagcgcccaactacaggtcatattttt
tttaacggttataatcttagtagtctgaaaacaaatgagattttgtctcttcgccgtcaa
attggaataatttttcaagaccatcatcttcttttagagcgtactgtttatgataacgtt
gcgataccattgattgtttgtggagaaagtttaaatattattcgccgtcgtgtacctgca
gctctagatagagtcggtcttctcgataaagccaaaaatactccgatacaattatctagg
ggagaaaaacaacttatcgctattgcacgagctataattaataaaccagcagttttagta
atcgacgaaccgacaaatcatttagatgatatagtatctaatactatattctgtttattt
gaagagtttaatcacataggtgtagcaatactaatggcaactattaatacaagactaata
gcaaaccgaaattatcgcgttttaacactccacaagggaaaagtcacagaaaacttacat
gcgaaataa

DBGET integrated database retrieval system