KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00071Help
Entry
A35E_00071        CDS       T02336                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  
ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Pentose phosphate pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A35E_00071
  Nucleotide metabolism
   00230 Purine metabolism
    A35E_00071
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     A35E_00071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(145235..146182)
Genome map
AA seq 315 aa AA seqDB search
MTDMKLFSGNAIPDLAQHIANRLYTSLGNAAVSRFSDGEVSVQINENVRGGDLFIIQSTC
QPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKIVADFLSGV
GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQQNLENPIVVSPDIGGVVRARAI
AKLLNDTDMAIIDKRRPRANISQVMHIIGDVADRDCILVDDMIDTGSTLCKAAEALKERG
ARRVFAYATHPIFSGQACQNIRDSLIDEVIVCDTIPLSPAIKELSNVRTLTLSGMLAEAI
RRISNEESLSAMFEY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacatgaagcttttttctggaaatgcgattccagatctagcgcaacatattgct
aatcgtttatatactagtctcgggaatgctgcagtgagtcgttttagtgatggcgaagtc
agcgtacaaattaatgaaaatgtgcgcggtggtgatctatttattattcaatctacgtgt
cagccgactaatgataatctaatggagttggtggttatggttgatgcactccggcgtgct
tctgccggtcgtatcactgcagtaattccttattttggttatgcacgacaagatcgtcgt
gtccgttctgctcgtgttccaattacagccaaaattgtagctgattttttatctggtgtt
ggtgtagatcgtgttttgacagtagacttgcacgctgagcagattcaaggtttttttgat
gttccagtggataatgtatttggtagcccaattctattggaagatatgctgcagcagaat
ttagaaaatcctattgttgtttctccagatattgggggcgttgttcgtgcaagagcaata
gcaaaattacttaacgatacggatatggcaattattgataaacgtcgtccgcgtgctaat
atatctcaagttatgcatattattggtgatgtggcggatcgggattgtattcttgttgat
gatatgattgatacaggcagtactttatgcaaagctgctgaagcgttaaaagagcgtggt
gctcgtcgtgtatttgcatatgcaacgcatccaattttttcgggacaagcgtgtcaaaat
attagagattcattgattgatgaagttattgtgtgtgacactattcctttgtcgccagct
attaaggaactttcaaacgtacgaactttgacactttctggtatgttagcagaggcgatt
cgccggattagtaatgaagagtctctttcagctatgtttgaatattaa

DBGET integrated database retrieval system