KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00072Help
Entry
A35E_00072        CDS       T02336                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A35E_00072
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     A35E_00072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(146320..146826)
Genome map
AA seq 168 aa AA seqDB search
MALNVQWCCGLDVATLENLGLSLGADVPLFIRGVAAFGEGVGDQLTLASFVEKWYFVAVP
PIGIETRSIFNDPELKRDSPRRSFSELMSLPFYNDCEPIVRKRFSIVEKHILWLLKYAPC
RLTGTGSCVFSEFDDEASAYQLLSKIPDWMHGFVARGVQVSPLYRALW
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcttaatgttcaatggtgctgtggtttagatgtagctactctagaaaacctgggt
ctttctctcggggcagatgttccgttatttatacgtggtgtagccgcttttggggaaggg
gttggagatcaacttacattggccagttttgttgaaaagtggtattttgtcgccgtaccg
ccaattggtattgaaacacgatctatttttaacgatcctgagcttaaaagagattcaccc
cgtcgttctttttctgagctcatgagcttacctttttataatgattgtgaaccaattgta
agaaaacgtttttccattgttgaaaagcatattttatggctattaaaatacgcaccatgt
cgacttacgggaacaggttcttgtgtgttttctgaatttgatgatgaagcttctgcctat
cagcttttatcaaagattcccgactggatgcatggattcgttgctcgaggtgtacaagtt
tctccattatatcgtgcgttatggtaa

DBGET integrated database retrieval system