KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00075Help
Entry
A35E_00075        CDS       T02336                                 

Definition
(GenBank) 3-deoxy-8-phosphooctulonate synthase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00540  Lipopolysaccharide biosynthesis
sehc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    A35E_00075
Enzymes [BR:sehc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     A35E_00075
Lipopolysaccharide biosynthesis proteins [BR:sehc01005]
 Unusual sugar
  A35E_00075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFP85397
UniProt: J3TG94
Position
complement(148633..149487)
Genome map
AA seq 284 aa AA seqDB search
MKDVVINIKDIQVGNKLPFVLFGGINVLESRDLAMQVCEHYCIITEKLGIPYIFKASFDK
ANRSSIYSYRGPGLEKGIKIFEDLKKHFGVKIVTDVHEIEQVSRIQDVVDVIQLPAFLAR
QTNLIEAMARSGVVINIKKPQFISPEQVGYIVEKFREFGNTQVILCDRGTNFGYDNLIVD
ILGFNIMKQVSGGCPVIFDVTHALQTRIAYSSTSGGRRKQIGELARAAMAVGIAGLFIEA
HPDPENAKCDGPSALSLNNLSSFLQQIREIDDLIKSFSLLDVEN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgttgtgattaatatcaaggatattcaggtagggaataagcttcctttcgtt
ctctttggtggaataaatgttttagaatcgcgagatttggcaatgcaggtttgcgaacac
tattgcatcattacggaaaaacttggaattccctacatattcaaggcttcatttgacaaa
gctaaccgttcttcaatttattcttatcgtggaccaggtttagaaaagggtataaaaatt
tttgaagacctaaaaaaacactttggtgtgaaaatagtaactgatgttcatgaaatcgaa
caagtaagcagaatacaagatgtagtagatgttattcaattaccagcatttcttgctcgg
caaactaatttaatagaggctatggcacgaagtggagttgtaataaatataaaaaaacct
caatttatcagcccagagcaagttgggtatattgtcgaaaagtttcgtgaattcggaaat
actcaagttatattatgcgatcgaggaactaattttggttatgataatctcatcgttgat
atacttggatttaacataatgaaacaagtatccggaggatgtccggttattttcgatgtt
actcatgctcttcagacccgtatagcgtattcttcaacctccggtggacggcgtaaacaa
ataggtgagttagctcgtgctgctatggcagtcggtattgctgggctatttattgaagct
caccccgatccagaaaatgcaaaatgcgatggtccttcggctttgtcgcttaataatttg
tcatctttcttgcaacagattcgagaaattgacgacttaattaagtctttttctttgctt
gatgttgagaactaa

DBGET integrated database retrieval system