KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00078Help
Entry
A35E_00078        CDS       T02336                                 

Definition
(GenBank) helicase subunit of the DNA excision repair complex
  KO
K03702  
excinuclease ABC subunit B
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    A35E_00078
DNA repair and recombination proteins [BR:sehc03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     A35E_00078
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      A35E_00078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
156351..156575
Genome map
AA seq 74 aa AA seqDB search
MTLTKRMAEDLTKYIEDQGEKVRYLHSDIETVERIEIIRDLRLGAFDILVGINLVRERLD
TPEVSLVAILDANL
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgacattgacaaaacgaatggcagaagatttaaccaaatatattgaagatcaaggtgaa
aaagtacgctatttacattcagatatagaaacggtggaacgaatagaaattatacgagac
ttacgtttaggtgcgtttgatatcctagtcggaattaatcttgtgcgtgaaagattagac
acacccgaagtgtctttagtagcaatcttagatgctaatctatag

DBGET integrated database retrieval system