KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00084Help
Entry
A35E_00084        CDS       T02336                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00057  
glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    A35E_00084
Enzymes [BR:sehc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     A35E_00084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
163973..164989
Genome map
AA seq 338 aa AA seqDB search
MYKNASMSVIGAGAYGTALSISLARNGHSVLLWGHNPAHIQQLKLTRCNKAFLPNIAFPP
SLHLEISLPVALSASPNILIVVPSHMFSSILKQIKPYLRADSRIVWATKGLDPETGRLLQ
EVAEDILGKQIPLAVLSGPTFASELAEGLPTAITLAATDSKFSIDLQRLLHCDENFRVYS
NSDIIGVQLGGAVKNVIAIGAGISDGIGFGANALTALITRGLTEMSRLGTAMGANPETFM
GMAGLGDLILSCTNNQSRNRQFGILIGQGITIEIAKKTAGKIVEGYRNTKEVLAVASRYG
IEMPITEQIYEVLYQGKDAYQAALTLLRRAKKSEKNNF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaaatgcttccatgagtgttattggcgcaggtgcttacggaacagctctatcc
attagcctagctcgaaatggtcatagtgtgttgctttgggggcacaatcccgctcatatc
caacaattaaaactaacacgctgcaataaagcttttttaccaaatatcgcttttccacca
tcactacacttagaaatatctctacctgtagccctgtccgctagtcccaatattctaatt
gtagtaccgagtcacatgtttagctctatacttaaacaaataaagccatatttgcgggca
gattctcgaatcgtttgggctacaaaaggattagatcctgaaacaggtagacttttacaa
gaagtggcagaagatattttaggtaaacaaatacccctagcagttctatcggggccaaca
tttgcctccgagttagcggaaggactacccacagctatcactctggcagctaccgattca
aaatttagcatcgatttacagcgtttgttacactgtgatgaaaattttcgggtgtatagt
aattccgatataatcggcgttcaattaggtggtgcagtaaagaatgttattgccattgga
gccggaatttctgatggtatcggttttggcgctaacgccttaacagcattaattacgcgg
gggttaactgaaatgtcacgactaggaaccgcgatgggtgcaaacccagaaacttttatg
ggaatggcaggattgggagatttaatccttagttgtaccaacaatcagtcacgaaaccgc
caattcggtatattgataggacaaggtattactatcgaaatagcaaaaaaaactgctgga
aaaatagtagaaggataccgtaataccaaagaagtattagcagtggcttctcgatacggc
atcgaaatgccaattactgagcaaatttatgaagtgctttatcaggggaaagacgcttac
caagcagctttaacactgcttcgtcgcgctaagaaatcagaaaagaataacttttaa

DBGET integrated database retrieval system